diff options
-rw-r--r-- | colorfilters | 4 | ||||
-rw-r--r-- | epan/libwireshark.def | 2 | ||||
-rw-r--r-- | plugins/infiniband/moduleinfo.h | 4 | ||||
-rw-r--r-- | plugins/infiniband/moduleinfo.nmake | 4 | ||||
-rw-r--r-- | plugins/infiniband/packet-infiniband.c | 3240 | ||||
-rw-r--r-- | plugins/infiniband/packet-infiniband.h | 2181 |
6 files changed, 5008 insertions, 427 deletions
diff --git a/colorfilters b/colorfilters index 3ed6cbf0e6..c89442c369 100644 --- a/colorfilters +++ b/colorfilters @@ -18,3 +18,7 @@ @TCP@tcp@[59345,58980,65534][0,0,0] @UDP@udp@[28834,57427,65533][0,0,0] @Broadcast@eth[0] & 1@[65535,65535,65535][32768,32768,32768] +@Subnet Management@infiniband.mad.mgmtclass == 0x81 || infiniband.mad.mgmtclass == 0x01@[2602,11570,65535][65535,65535,65535] +@Subnet Administration@infiniband.mad.mgmtclass == 0x03@[6957,36050,61400][65535,65535,65535] +@Not Implemented@infiniband.mad.mgmtclass != 0x81 && infiniband.mad.mgmtclass != 0x03 && infiniband.mad.mgmtclass != 0x01@[52640,31280,10653][65535,65535,65535] +@Infiniband Data@infiniband.lrh.vl != 0x0f@[6660,20360,11712][65535,65535,65535] diff --git a/epan/libwireshark.def b/epan/libwireshark.def index a03745f77c..5833badfa9 100644 --- a/epan/libwireshark.def +++ b/epan/libwireshark.def @@ -336,6 +336,7 @@ epan_dissect_run epan_get_version epan_init epan_strcasestr +ethertype ether_to_str ex_opt_add ex_opt_count @@ -822,6 +823,7 @@ se_tree_create_non_persistent set_actual_length set_profile_name set_tap_dfilter +show_exception show_fragment_seq_tree show_fragment_tree sid_name_snooping DATA diff --git a/plugins/infiniband/moduleinfo.h b/plugins/infiniband/moduleinfo.h index 2c7ded04d2..97a1fd2f75 100644 --- a/plugins/infiniband/moduleinfo.h +++ b/plugins/infiniband/moduleinfo.h @@ -13,6 +13,4 @@ #endif /* Version number of package */ -#define VERSION "1.0.1.0" - - +#define VERSION "1.2.0" diff --git a/plugins/infiniband/moduleinfo.nmake b/plugins/infiniband/moduleinfo.nmake index df5a2740ce..3b514a3bde 100644 --- a/plugins/infiniband/moduleinfo.nmake +++ b/plugins/infiniband/moduleinfo.nmake @@ -7,8 +7,8 @@ PACKAGE=infiniband # The version MODULE_VERSION_MAJOR=1 -MODULE_VERSION_MINOR=0 -MODULE_VERSION_MICRO=1 +MODULE_VERSION_MINOR=2 +MODULE_VERSION_MICRO=0 MODULE_VERSION_EXTRA=0 # diff --git a/plugins/infiniband/packet-infiniband.c b/plugins/infiniband/packet-infiniband.c index 2fdf259f69..a9ecbc2e7c 100644 --- a/plugins/infiniband/packet-infiniband.c +++ b/plugins/infiniband/packet-infiniband.c @@ -31,8 +31,11 @@ #include <epan/prefs.h> #include <epan/proto.h> #include <string.h> +#include <epan/dissectors/packet-frame.h> #include "packet-infiniband.h" + +/* Protocol Registration */ void proto_register_infiniband(void) { if(proto_infiniband == -1) @@ -46,16 +49,28 @@ void proto_register_infiniband(void) } +/* Reg Handoff. Register dissectors we'll need for IPoIB */ void proto_reg_handoff_infiniband(void) { static int initialized=FALSE; if(!initialized) { infiniband_handle = create_dissector_handle(dissect_infiniband, proto_infiniband); + ipv6_handle = find_dissector("ipv6"); + ip_handle = find_dissector("ip"); + arp_handle = find_dissector("arp"); + rarp_handle = find_dissector("rarp"); + data_handle = find_dissector("data"); + ethertype_dissector_table = find_dissector_table("ethertype"); } } +/* Main Dissector */ +/* Notes: */ +/* 1.) Floating "offset+=" statements should probably be "functionized" but they are inline */ +/* Offset is only passed by reference in specific places, so do not be confused when following code */ +/* In any code path, adding up "offset+=" statements will tell you what byte you are at */ static void dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) { @@ -77,21 +92,23 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) proto_tree *base_transport_header_tree = NULL; proto_item *base_transport_header_item = NULL; - /* Raw Data - no decoding. */ - proto_item *raw_ipv6 = NULL; - proto_item *raw_RWH_Ethertype; + /* Raw Data */ + proto_tree *RAWDATA_header_tree; + proto_item *RAWDATA_header_item; + guint8 lnh_val = 0; /* Link Next Header Value */ + gint offset = 0; /* Current Offset */ + /* General Variables */ gboolean bthFollows = 0; /* Tracks if we are parsing a BTH. This is a significant decision point */ - guint8 lnh_val = 0; /* Link Next Header Value */ - gint offset = 0; /* Current Offset */ + guint8 virtualLane = 0; /* IB VirtualLane. Keyed off of for detecting subnet admin/management */ guint8 opCode = 0; /* OpCode from BTH header. */ gint32 nextHeaderSequence = -1; /* defined by this dissector. #define which indicates the upcoming header sequence from OpCode */ guint16 payloadLength = 0; /* Payload Length should it exist */ - guint8 nxtHdr = 0; /* */ - guint16 packetLength = 0; /* Packet Length. We track this as tvb->length - offset. It provides the parsing methods a known size */ - /* that must be available for that header. */ - e_guid_t SRCguid; - e_guid_t DSTguid; + guint8 nxtHdr = 0; /* Keyed off for header dissection order */ + guint16 packetLength = 0; /* Packet Length. We track this as tvb->length - offset. It provides the parsing methods a known size */ /* that must be available for that header. */ + struct e_in6_addr SRCgid; /* Structures to hold GIDs should be need them */ + struct e_in6_addr DSTgid; + gint crc_length = 0; /* Mark the Packet type as Infiniband in the wireshark UI */ /* Clear other columns */ @@ -101,50 +118,64 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) col_set_str(pinfo->cinfo, COL_PROTOCOL, "InfiniBand"); if(check_col(pinfo->cinfo, COL_INFO)) col_clear(pinfo->cinfo, COL_INFO); + + g_cinfo = pinfo->cinfo; } - /* Get the parent tree from the ERF dissector */ + /* Global ref to Pinfo for dissection routines where necessary */ + g_pinfo = pinfo; + + /* Get the parent tree from the ERF dissector. We don't want to nest under ERF */ if(tree && tree->parent) { + /* Set the normal tree outside of ERF */ tree = tree->parent; + /* Set a global reference for nested protocols */ + top_tree = tree; + } + + if(!tree) + { + /* If no packet details are being dissected, extract some high level info for the packet view */ + /* Assigns column values rather than full tree population */ + dissect_general_info(tvb, offset, pinfo); + return; } - if(tree) - { - /* proto_tree* proto_item_add_subtree(proto_item *ti, gint idx); */ + /* Top Level Packet */ + infiniband_packet = proto_tree_add_item(tree, proto_infiniband, tvb, offset, -1, FALSE); - /* Top Level Packet */ - infiniband_packet = proto_tree_add_item(tree, proto_infiniband, tvb, offset, -1, FALSE); + /* Headers Level Tree */ + all_headers_tree = proto_item_add_subtree(infiniband_packet, ett_all_headers); - /* Headers Level Tree */ - all_headers_tree = proto_item_add_subtree(infiniband_packet, ett_infiniband); + /* Local Route Header Subtree */ + local_route_header_item = proto_tree_add_bytes(all_headers_tree, hf_infiniband_LRH, tvb, offset, 8, tvb->real_data); + proto_item_set_text(local_route_header_item, "%s", "Local Route Header"); + local_route_header_tree = proto_item_add_subtree(local_route_header_item, ett_lrh); - /* Local Route Header Subtree */ - local_route_header_item = proto_tree_add_bytes(all_headers_tree, hf_infiniband_LRH, tvb, offset, 8, tvb->real_data); - proto_item_set_text(local_route_header_item, "%s", "Local Route Header"); - local_route_header_tree = proto_item_add_subtree(local_route_header_item, ett_infiniband); + proto_tree_add_item(local_route_header_tree, hf_infiniband_virtual_lane, tvb, offset, 1, FALSE); + + + /* Get the Virtual Lane. We'll use this to identify Subnet Management and Subnet Administration Packets. */ + virtualLane = tvb_get_guint8(tvb, offset); + virtualLane = virtualLane & 0xF0; + + + proto_tree_add_item(local_route_header_tree, hf_infiniband_link_version, tvb, offset, 1, FALSE); offset+=1; + proto_tree_add_item(local_route_header_tree, hf_infiniband_service_level, tvb, offset, 1, FALSE); + + proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved2, tvb, offset, 1, FALSE); + proto_tree_add_item(local_route_header_tree, hf_infiniband_link_next_header, tvb, offset, 1, FALSE); - proto_tree_add_item(local_route_header_tree, hf_infiniband_virtual_lane, tvb, offset, 1, FALSE); - proto_tree_add_item(local_route_header_tree, hf_infiniband_link_version, tvb, offset, 1, FALSE); offset+=1; - proto_tree_add_item(local_route_header_tree, hf_infiniband_service_level, tvb, offset, 1, FALSE); - proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved2, tvb, offset, 1, FALSE); - proto_tree_add_item(local_route_header_tree, hf_infiniband_link_next_header, tvb, offset, 1, FALSE); - } - else - { - offset+=1; - } - /* Save Link Next Header... This tells us what the next header is. */ lnh_val = tvb_get_guint8(tvb, offset); lnh_val = lnh_val & 0x03; offset+=1; - if(tree) - { - proto_tree_add_item(local_route_header_tree, hf_infiniband_destination_local_id, tvb, offset, 2, FALSE); - } + + proto_tree_add_item(local_route_header_tree, hf_infiniband_destination_local_id, tvb, offset, 2, FALSE); + /* Set destination in packet view. */ if (check_col(pinfo->cinfo, COL_DEF_DST)) @@ -155,24 +186,15 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) } offset+=2; - if(tree) - { - proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved5, tvb, offset, 2, FALSE); - } + + proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved5, tvb, offset, 2, FALSE); packetLength = tvb_get_ntohs(tvb, offset); /* Get the Packet Length. This will determine payload size later on. */ packetLength = packetLength & 0x07FF; /* Mask off top 5 bits, they are reserved */ - packetLength = packetLength * 4; /* Multiply by 4 to get true byte length. This is by specification. PktLen is size in 4 byte words (byteSize /4). */ - - if(tree) - { - proto_tree_add_item(local_route_header_tree, hf_infiniband_packet_length, tvb, offset, 2, FALSE); offset+=2; - proto_tree_add_item(local_route_header_tree, hf_infiniband_source_local_id, tvb, offset, 2, FALSE); - } - else - { - offset+=2; - } + packetLength = packetLength * 4; /* Multiply by 4 to get true byte length. This is by specification. PktLen is size in 4 byte words (byteSize /4). */ + + proto_tree_add_item(local_route_header_tree, hf_infiniband_packet_length, tvb, offset, 2, FALSE); offset+=2; + proto_tree_add_item(local_route_header_tree, hf_infiniband_source_local_id, tvb, offset, 2, FALSE); /* Set Source in packet view. */ if (check_col(pinfo->cinfo, COL_DEF_SRC)) @@ -181,158 +203,122 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) col_set_fence(pinfo->cinfo, COL_DEF_SRC); col_set_str(pinfo->cinfo, COL_DEF_SRC, tvb_bytes_to_str(tvb, offset, 2)); } + offset+=2; packetLength -= 8; /* Shave 8 bytes for the LRH. */ + /* Key off Link Next Header. This tells us what High Level Data Format we have */ switch(lnh_val) { case IBA_GLOBAL: - payloadLength = tvb_get_ntohs(tvb, offset + 4); - nxtHdr = tvb_get_guint8(tvb, offset + 6); - if(tree) - { - global_route_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_GRH, tvb, offset, 40, FALSE); - proto_item_set_text(global_route_header_item, "%s", "Global Route Header"); - global_route_header_tree = proto_item_add_subtree(global_route_header_item, ett_infiniband); - proto_tree_add_item(global_route_header_tree, hf_infiniband_ip_version, tvb, offset, 1, FALSE); - proto_tree_add_item(global_route_header_tree, hf_infiniband_traffic_class, tvb, offset, 2, FALSE); - proto_tree_add_item(global_route_header_tree, hf_infiniband_flow_label, tvb, offset, 4, FALSE); offset += 4; - proto_tree_add_item(global_route_header_tree, hf_infiniband_payload_length, tvb, offset, 2, FALSE); offset += 2; - proto_tree_add_item(global_route_header_tree, hf_infiniband_next_header, tvb, offset, 1, FALSE); offset +=1; - proto_tree_add_item(global_route_header_tree, hf_infiniband_hop_limit, tvb, offset, 1, FALSE); offset +=1; - proto_tree_add_item(global_route_header_tree, hf_infiniband_source_gid, tvb, offset, 16, FALSE); - } - else - { - offset+=8; - } + global_route_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_GRH, tvb, offset, 40, FALSE); + proto_item_set_text(global_route_header_item, "%s", "Global Route Header"); + global_route_header_tree = proto_item_add_subtree(global_route_header_item, ett_grh); + + proto_tree_add_item(global_route_header_tree, hf_infiniband_ip_version, tvb, offset, 1, FALSE); + proto_tree_add_item(global_route_header_tree, hf_infiniband_traffic_class, tvb, offset, 2, FALSE); + proto_tree_add_item(global_route_header_tree, hf_infiniband_flow_label, tvb, offset, 4, FALSE); offset += 4; + + payloadLength = tvb_get_ntohs(tvb, offset); + + proto_tree_add_item(global_route_header_tree, hf_infiniband_payload_length, tvb, offset, 2, FALSE); offset += 2; - tvb_get_ntohguid(tvb, offset,&SRCguid); + nxtHdr = tvb_get_guint8(tvb, offset); + + proto_tree_add_item(global_route_header_tree, hf_infiniband_next_header, tvb, offset, 1, FALSE); offset +=1; + proto_tree_add_item(global_route_header_tree, hf_infiniband_hop_limit, tvb, offset, 1, FALSE); offset +=1; + proto_tree_add_item(global_route_header_tree, hf_infiniband_source_gid, tvb, offset, 16, FALSE); + + tvb_get_ipv6(tvb, offset, &SRCgid); if (check_col(pinfo->cinfo, COL_DEF_SRC)) { col_set_str(pinfo->cinfo, COL_DEF_SRC, "SGID: "); col_set_fence(pinfo->cinfo, COL_DEF_SRC); - col_set_str(pinfo->cinfo, COL_DEF_SRC, guid_to_str(&SRCguid)); + col_set_str(pinfo->cinfo, COL_DEF_SRC, ip6_to_str(&SRCgid)); } offset += 16; - if(tree) - { - proto_tree_add_item(global_route_header_tree, hf_infiniband_destination_gid, tvb, offset, 16, FALSE); offset +=16; - } - else - { - offset+=16; - } + proto_tree_add_item(global_route_header_tree, hf_infiniband_destination_gid, tvb, offset, 16, FALSE); - tvb_get_ntohguid(tvb, offset, &DSTguid); + tvb_get_ipv6(tvb, offset, &DSTgid); if (check_col(pinfo->cinfo, COL_DEF_DST)) { col_set_str(pinfo->cinfo, COL_DEF_DST, "DGID: "); col_set_fence(pinfo->cinfo, COL_DEF_DST); - col_set_str(pinfo->cinfo, COL_DEF_DST, guid_to_str(&DSTguid)); + col_set_str(pinfo->cinfo, COL_DEF_DST, ip6_to_str(&DSTgid)); } offset += 16; - - - packetLength -= 40; /* Shave 40 bytes for GRH */ + if(nxtHdr != 0x1B) { - if(tree) - { - /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */ - proto_tree *RAWDATA_header_tree = NULL; - proto_item *RAWDATA_header_item = NULL; - RAWDATA_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE); - proto_item_set_text(RAWDATA_header_item, "%s", "Raw Data - Non IBA local transport"); - RAWDATA_header_tree = proto_item_add_subtree(RAWDATA_header_item, ett_infiniband); - } - break; + /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */ + break; } - /* otherwise fall through and start parsing BTH */ - case IBA_LOCAL: bthFollows = TRUE; + base_transport_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_BTH, tvb, offset, 12, FALSE); + proto_item_set_text(base_transport_header_item, "%s", "Base Transport Header"); + base_transport_header_tree = proto_item_add_subtree(base_transport_header_item, ett_bth); + proto_tree_add_item(base_transport_header_tree, hf_infiniband_opcode, tvb, offset, 1, FALSE); - if(tree) - { - base_transport_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_BTH, tvb, offset, 12, FALSE); - proto_item_set_text(base_transport_header_item, "%s", "Base Transport Header"); - base_transport_header_tree = proto_item_add_subtree(base_transport_header_item, ett_infiniband); - proto_tree_add_item(base_transport_header_tree, hf_infiniband_opcode, tvb, offset, 1, FALSE); - } /* Get the OpCode - this tells us what headers are following */ opCode = tvb_get_guint8(tvb, offset); if (check_col(pinfo->cinfo, COL_INFO)) { - col_set_str(pinfo->cinfo, COL_INFO, " "); - col_set_fence(pinfo->cinfo, COL_INFO); - col_set_str(pinfo->cinfo, COL_INFO, val_to_str((guint32)opCode, OpCodeMap, "Unknown OpCode")); + col_append_str(pinfo->cinfo, COL_INFO, val_to_str((guint32)opCode, OpCodeMap, "Unknown OpCode")); } offset +=1; - if(tree) - { - proto_tree_add_item(base_transport_header_tree, hf_infiniband_solicited_event, tvb, offset, 1, FALSE); - proto_tree_add_item(base_transport_header_tree, hf_infiniband_migreq, tvb, offset, 1, FALSE); - proto_tree_add_item(base_transport_header_tree, hf_infiniband_pad_count, tvb, offset, 1, FALSE); - proto_tree_add_item(base_transport_header_tree, hf_infiniband_transport_header_version, tvb, offset, 1, FALSE); offset +=1; - proto_tree_add_item(base_transport_header_tree, hf_infiniband_partition_key, tvb, offset, 2, FALSE); offset +=2; - proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved8, tvb, offset, 1, FALSE); offset +=1; - proto_tree_add_item(base_transport_header_tree, hf_infiniband_destination_qp, tvb, offset, 3, FALSE); offset +=3; - proto_tree_add_item(base_transport_header_tree, hf_infiniband_acknowledge_request, tvb, offset, 1, FALSE); - proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved7, tvb, offset, 1, FALSE); offset +=1; - proto_tree_add_item(base_transport_header_tree, hf_infiniband_packet_sequence_number, tvb, offset, 3, FALSE); offset +=3; - } - else - { - offset+=11; - } + + proto_tree_add_item(base_transport_header_tree, hf_infiniband_solicited_event, tvb, offset, 1, FALSE); + proto_tree_add_item(base_transport_header_tree, hf_infiniband_migreq, tvb, offset, 1, FALSE); + proto_tree_add_item(base_transport_header_tree, hf_infiniband_pad_count, tvb, offset, 1, FALSE); + proto_tree_add_item(base_transport_header_tree, hf_infiniband_transport_header_version, tvb, offset, 1, FALSE); offset +=1; + proto_tree_add_item(base_transport_header_tree, hf_infiniband_partition_key, tvb, offset, 2, FALSE); offset +=2; + proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved8, tvb, offset, 1, FALSE); offset +=1; + proto_tree_add_item(base_transport_header_tree, hf_infiniband_destination_qp, tvb, offset, 3, FALSE); offset +=3; + proto_tree_add_item(base_transport_header_tree, hf_infiniband_acknowledge_request, tvb, offset, 1, FALSE); + proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved7, tvb, offset, 1, FALSE); offset +=1; + proto_tree_add_item(base_transport_header_tree, hf_infiniband_packet_sequence_number, tvb, offset, 3, FALSE); offset +=3; + packetLength -= 12; /* Shave 12 for Base Transport Header */ break; case IP_NON_IBA: - if(!tree) + /* Raw IPv6 Packet */ + if (check_col(pinfo->cinfo, COL_DEF_DST)) { - break; + col_set_str(pinfo->cinfo, COL_DEF_DST, "IPv6 over IB Packet"); + col_set_fence(pinfo->cinfo, COL_DEF_DST); } - - /* Raw IPv6 Packet */ - raw_ipv6 = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE); - proto_item_set_text(raw_ipv6, "%s", "Raw (non-IBA Transport) IPv6 Packet"); + parse_IPvSix(all_headers_tree, tvb, &offset, pinfo); break; case RAW: - if(!tree) - { - break; - } - - /* Raw (any other) Packet */ - raw_RWH_Ethertype = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE); - proto_item_set_text(raw_RWH_Ethertype, "%s", "Raw (non-IBA Transport) Packet"); - + parse_RWH(all_headers_tree, tvb, &offset, pinfo); break; default: - if(!tree) - { - break; - } - /* Unknown Packet */ - raw_ipv6 = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE); - proto_item_set_text(raw_ipv6, "%s", "Unknown (non-IBA Transport) Raw Data Packet"); + RAWDATA_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE); + proto_item_set_text(RAWDATA_header_item, "%s", "Unknown Raw Data - IB Encapsulated"); + RAWDATA_header_tree = proto_item_add_subtree(RAWDATA_header_item, ett_rawdata); break; } - if(bthFollows && tree) + /* Base Transport header is hit quite often, however it is alone since it is the exception not the rule */ + /* Only IBA Local packets use it */ + if(bthFollows) { - /* Find our next header sequence based on the Opcode */ - /* Each case decrements the packetLength by the amount of bytes consumed by each header. */ - /* The find_next_header_sequence method could be used to automate this. */ - /* We need to keep track of this so we know much data to mark as payload/ICRC/VCRC values. */ + /* Find our next header sequence based on the Opcode + * Each case decrements the packetLength by the amount of bytes consumed by each header. + * The find_next_header_sequence method could be used to automate this. + * We need to keep track of this so we know much data to mark as payload/ICRC/VCRC values. */ + nextHeaderSequence = find_next_header_sequence((guint32) opCode); + + /* find_next_header_sequence gives us the DEFINE value corresponding to the header order following */ + /* Enumerations are named intuitively, e.g. RDETH DETH PAYLOAD means there is an RDETH Header, DETH Header, and a packet payload */ switch(nextHeaderSequence) { case RDETH_DETH_PAYLD: @@ -342,7 +328,7 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) packetLength -= 4; /* RDETH */ packetLength -= 8; /* DETH */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case RDETH_DETH_RETH_PAYLD: parse_RDETH(all_headers_tree, tvb, &offset); @@ -353,7 +339,7 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) packetLength -= 8; /* DETH */ packetLength -= 16; /* RETH */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case RDETH_DETH_IMMDT_PAYLD: parse_RDETH(all_headers_tree, tvb, &offset); @@ -364,7 +350,7 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) packetLength -= 8; /* DETH */ packetLength -= 4; /* IMMDT */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case RDETH_DETH_RETH_IMMDT_PAYLD: parse_RDETH(all_headers_tree, tvb, &offset); @@ -377,7 +363,7 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) packetLength -= 16; /* RETH */ packetLength -= 4; /* IMMDT */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case RDETH_DETH_RETH: parse_RDETH(all_headers_tree, tvb, &offset); @@ -396,14 +382,14 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) packetLength -= 4; /* RDETH */ packetLength -= 4; /* AETH */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case RDETH_PAYLD: parse_RDETH(all_headers_tree, tvb, &offset); packetLength -= 4; /* RDETH */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case RDETH_AETH: parse_AETH(all_headers_tree, tvb, &offset); @@ -447,25 +433,25 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) packetLength -= 8; /* DETH */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case PAYLD: - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case IMMDT_PAYLD: parse_IMMDT(all_headers_tree, tvb, &offset); packetLength -= 4; /* IMMDT */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case RETH_PAYLD: parse_RETH(all_headers_tree, tvb, &offset); packetLength -= 16; /* RETH */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case RETH: parse_RETH(all_headers_tree, tvb, &offset); @@ -478,7 +464,7 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) packetLength -= 4; /* AETH */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case AETH: parse_AETH(all_headers_tree, tvb, &offset); @@ -505,7 +491,7 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) packetLength -= 4; /* IETH */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; case DETH_IMMDT_PAYLD: parse_DETH(all_headers_tree, tvb, &offset); @@ -514,22 +500,41 @@ dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree) packetLength -= 8; /* DETH */ packetLength -= 4; /* IMMDT */ - parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength); + parse_PAYLOAD(all_headers_tree, tvb, &offset, packetLength, virtualLane); break; default: parse_VENDOR(all_headers_tree, tvb, &offset); break; + } + + } + /* Display the ICRC/VCRC */ + /* Doing it this way rather than in a variety of places according to the specific packet */ + /* If we've already displayed it crc_length comes out 0 */ + crc_length = tvb_reported_length_remaining(tvb, offset); + if(crc_length == 6) + { + proto_tree_add_item(all_headers_tree, hf_infiniband_invariant_crc, tvb, offset, 4, FALSE); offset +=4; + proto_tree_add_item(all_headers_tree, hf_infiniband_variant_crc, tvb, offset, 2, FALSE); offset+=2; + } + else if(crc_length == 4) + { + proto_tree_add_item(all_headers_tree, hf_infiniband_invariant_crc, tvb, offset, 4, FALSE); offset +=4; + } + else if(crc_length == 2) + { + proto_tree_add_item(all_headers_tree, hf_infiniband_variant_crc, tvb, offset, 2, FALSE); offset+=2; } + } - -/* Description: Finds the header sequence that follows the Base Transport Header. */ -/* Somwhat inefficient (should be using a single key,value pair data structure) */ -/* But uses pure probablity to take a stab at better efficiency. */ -/* Searches largest header sequence groups first, and then finally resorts to single matches for unique header sequences */ -/* IN: OpCode: The OpCode from the Base Transport Header. */ -/* OUT: The Header Sequence enumeration. See Declarations for #defines from (0-22) */ +/* Description: Finds the header sequence that follows the Base Transport Header. +* Somwhat inefficient (should be using a single key,value pair data structure) +* But uses pure probablity to take a stab at better efficiency. +* Searches largest header sequence groups first, and then finally resorts to single matches for unique header sequences +* IN: OpCode: The OpCode from the Base Transport Header. +* OUT: The Header Sequence enumeration. See Declarations for #defines from (0-22) */ static gint32 find_next_header_sequence(guint32 OpCode) { @@ -605,12 +610,12 @@ find_next_header_sequence(guint32 OpCode) return -1; } -/* Description: Finds if a given value is present in an array. This is probably in a standard library somewhere, */ -/* But I'd rather define my own. */ -/* IN: OpCode: The OpCode you are looking for */ -/* IN: Codes: The organized array of OpCodes to look through */ -/* IN: Array length, because we're in C... */ -/* OUT: Boolean indicating if that OpCode was found in OpCodes */ +/* Description: Finds if a given value is present in an array. This is probably in a standard library somewhere, +* But I'd rather define my own. +* IN: OpCode: The OpCode you are looking for +* IN: Codes: The organized array of OpCodes to look through +* IN: Array length, because we're in C++... +* OUT: Boolean indicating if that OpCode was found in OpCodes */ static gboolean contains(guint32 OpCode, guint32* Codes, gint32 length) { @@ -623,10 +628,10 @@ contains(guint32 OpCode, guint32* Codes, gint32 length) return FALSE; } -/* Parse RDETH - Reliable Datagram Extended Transport Header */ -/* IN: parentTree to add the dissection too - in this code the all_headers_tree */ -/* IN: tvb - the data buffer from wireshark */ -/* IN/OUT: The current and updated offset */ +/* Parse RDETH - Reliable Datagram Extended Transport Header +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ static void parse_RDETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) { @@ -637,18 +642,17 @@ parse_RDETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) RDETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_RDETH, tvb, local_offset, 4, FALSE); proto_item_set_text(RDETH_header_item, "%s", "RDETH - Reliable Datagram Extended Transport Header"); - RDETH_header_tree = proto_item_add_subtree(RDETH_header_item, ett_infiniband); - - proto_tree_add_item(RDETH_header_tree, hf_infiniband_reserved8_RDETH, tvb, local_offset, 1, FALSE); local_offset+=1; - proto_tree_add_item(RDETH_header_tree, hf_infiniband_ee_context, tvb, local_offset, 3, FALSE); local_offset+=3; + RDETH_header_tree = proto_item_add_subtree(RDETH_header_item, ett_rdeth); + proto_tree_add_item(RDETH_header_tree, hf_infiniband_reserved8_RDETH, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(RDETH_header_tree, hf_infiniband_ee_context, tvb, local_offset, 3, FALSE); local_offset+=3; *offset = local_offset; } -/* Parse DETH - Datagram Extended Transport Header */ -/* IN: parentTree to add the dissection too - in this code the all_headers_tree */ -/* IN: tvb - the data buffer from wireshark */ -/* IN/OUT: The current and updated offset */ +/* Parse DETH - Datagram Extended Transport Header +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ static void parse_DETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) { @@ -659,7 +663,7 @@ parse_DETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) DETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_DETH, tvb, local_offset, 8, FALSE); proto_item_set_text(DETH_header_item, "%s", "DETH - Datagram Extended Transport Header"); - DETH_header_tree = proto_item_add_subtree(DETH_header_item, ett_infiniband); + DETH_header_tree = proto_item_add_subtree(DETH_header_item, ett_deth); proto_tree_add_item(DETH_header_tree, hf_infiniband_queue_key, tvb, local_offset, 4, FALSE); local_offset+=4; proto_tree_add_item(DETH_header_tree, hf_infiniband_reserved8_DETH, tvb, local_offset, 1, FALSE); local_offset+=1; @@ -668,10 +672,10 @@ parse_DETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) *offset = local_offset; } -/* Parse RETH - RDMA Extended Transport Header */ -/* IN: parentTree to add the dissection too - in this code the all_headers_tree */ -/* IN: tvb - the data buffer from wireshark */ -/* IN/OUT: The current and updated offset */ +/* Parse RETH - RDMA Extended Transport Header +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ static void parse_RETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) { @@ -682,7 +686,7 @@ parse_RETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) RETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_RETH, tvb, local_offset, 16, FALSE); proto_item_set_text(RETH_header_item, "%s", "RETH - RDMA Extended Transport Header"); - RETH_header_tree = proto_item_add_subtree(RETH_header_item, ett_infiniband); + RETH_header_tree = proto_item_add_subtree(RETH_header_item, ett_reth); proto_tree_add_item(RETH_header_tree, hf_infiniband_virtual_address, tvb, local_offset, 8, FALSE); local_offset+=8; proto_tree_add_item(RETH_header_tree, hf_infiniband_remote_key, tvb, local_offset, 4, FALSE); local_offset+=4; @@ -691,10 +695,10 @@ parse_RETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) *offset = local_offset; } -/* Parse AtomicETH - Atomic Extended Transport Header */ -/* IN: parentTree to add the dissection too - in this code the all_headers_tree */ -/* IN: tvb - the data buffer from wireshark */ -/* IN/OUT: The current and updated offset */ +/* Parse AtomicETH - Atomic Extended Transport Header +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ static void parse_ATOMICETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) { @@ -705,20 +709,19 @@ parse_ATOMICETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) ATOMICETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AtomicETH, tvb, local_offset, 28, FALSE); proto_item_set_text(ATOMICETH_header_item, "%s", "AtomicETH - Atomic Extended Transport Header"); - ATOMICETH_header_tree = proto_item_add_subtree(ATOMICETH_header_item, ett_infiniband); + ATOMICETH_header_tree = proto_item_add_subtree(ATOMICETH_header_item, ett_atomiceth); proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_virtual_address, tvb, local_offset, 8, FALSE); local_offset+=8; proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_remote_key, tvb, local_offset, 4, FALSE); local_offset+=4; proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_swap_or_add_data, tvb, local_offset, 8, FALSE); local_offset+=8; proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_compare_data, tvb, local_offset, 8, FALSE); local_offset+=8; - *offset = local_offset; } -/* Parse AETH - ACK Extended Transport Header */ -/* IN: parentTree to add the dissection too - in this code the all_headers_tree */ -/* IN: tvb - the data buffer from wireshark */ -/* IN/OUT: The current and updated offset */ +/* Parse AETH - ACK Extended Transport Header +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ static void parse_AETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) { @@ -729,7 +732,7 @@ parse_AETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) AETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AETH, tvb, local_offset, 4, FALSE); proto_item_set_text(AETH_header_item, "%s", "AETH - ACK Extended Transport Header"); - AETH_header_tree = proto_item_add_subtree(AETH_header_item, ett_infiniband); + AETH_header_tree = proto_item_add_subtree(AETH_header_item, ett_aeth); proto_tree_add_item(AETH_header_tree, hf_infiniband_syndrome, tvb, local_offset, 1, FALSE); local_offset+=1; proto_tree_add_item(AETH_header_tree, hf_infiniband_message_sequence_number, tvb, local_offset, 3, FALSE); local_offset+=3; @@ -737,10 +740,10 @@ parse_AETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) *offset = local_offset; } -/* Parse AtomicAckEth - Atomic ACK Extended Transport Header */ -/* IN: parentTree to add the dissection too - in this code the all_headers_tree */ -/* IN: tvb - the data buffer from wireshark */ -/* IN/OUT: The current and updated offset */ +/* Parse AtomicAckEth - Atomic ACK Extended Transport Header +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ static void parse_ATOMICACKETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) { @@ -751,17 +754,15 @@ parse_ATOMICACKETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) ATOMICACKETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AtomicAckETH, tvb, local_offset, 8, FALSE); proto_item_set_text(ATOMICACKETH_header_item, "%s", "ATOMICACKETH - Atomic ACK Extended Transport Header"); - ATOMICACKETH_header_tree = proto_item_add_subtree(ATOMICACKETH_header_item, ett_infiniband); - + ATOMICACKETH_header_tree = proto_item_add_subtree(ATOMICACKETH_header_item, ett_atomicacketh); proto_tree_add_item(ATOMICACKETH_header_tree, hf_infiniband_original_remote_data, tvb, local_offset, 8, FALSE); local_offset+=8; - *offset = local_offset; } -/* Parse IMMDT - Immediate Data Extended Transport Header */ -/* IN: parentTree to add the dissection too - in this code the all_headers_tree */ -/* IN: tvb - the data buffer from wireshark */ -/* IN/OUT: The current and updated offset */ +/* Parse IMMDT - Immediate Data Extended Transport Header +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ static void parse_IMMDT(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) { @@ -772,17 +773,15 @@ parse_IMMDT(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) IMMDT_header_item = proto_tree_add_item(parentTree, hf_infiniband_IMMDT, tvb, local_offset, 4, FALSE); proto_item_set_text(IMMDT_header_item, "%s", "IMMDT - Immediate Data Extended Transport Header"); - IMMDT_header_tree = proto_item_add_subtree(IMMDT_header_item, ett_infiniband); - + IMMDT_header_tree = proto_item_add_subtree(IMMDT_header_item, ett_immdt); proto_tree_add_item(IMMDT_header_tree, hf_infiniband_IMMDT, tvb, local_offset, 4, FALSE); local_offset+=4; - *offset = local_offset; } -/* Parse IETH - Invalidate Extended Transport Header */ -/* IN: parentTree to add the dissection too - in this code the all_headers_tree */ -/* IN: tvb - the data buffer from wireshark */ -/* IN/OUT: The current and updated offset */ +/* Parse IETH - Invalidate Extended Transport Header +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ static void parse_IETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) { @@ -793,67 +792,2798 @@ parse_IETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) IETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_IETH, tvb, local_offset, 4, FALSE); proto_item_set_text(IETH_header_item, "%s", "IETH - Invalidate Extended Transport Header"); - IETH_header_tree = proto_item_add_subtree(IETH_header_item, ett_infiniband); + IETH_header_tree = proto_item_add_subtree(IETH_header_item, ett_ieth); proto_tree_add_item(IETH_header_tree, hf_infiniband_IETH, tvb, local_offset, 4, FALSE); local_offset+=4; *offset = local_offset; } -/* Parse Payload - Packet Payload / Invariant CRC / Variant CRC */ -/* IN: parentTree to add the dissection too - in this code the all_headers_tree */ -/* IN: tvb - the data buffer from wireshark */ -/* IN/OUT: The current and updated offset */ -/* IN: Length of Payload */ -static void -parse_PAYLOAD(proto_tree * parentTree, tvbuff_t *tvb, gint *offset, gint length) +/* Parse Payload - Packet Payload / Invariant CRC / Variant CRC +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset +* IN: Length of Payload */ +static void parse_PAYLOAD(proto_tree * parentTree, tvbuff_t *tvb, gint *offset, gint length, guint8 virtualLane) { gint local_offset = *offset; /* Payload - Packet Payload */ proto_tree *PAYLOAD_header_tree = NULL; proto_item *PAYLOAD_header_item = NULL; - - if((length + local_offset) >= (gint)(tvb->length)) /* oreviously consumed bytes + offset was all the data - none or corrupt payload*/ + guint8 management_class; + tvbuff_t *next_tvb; + gint captured_length, reported_length; + guint16 etype, reserved; + const char *saved_proto; + volatile gboolean dissector_found = FALSE; + + if(!tvb_bytes_exist(tvb, *offset, length)) /* previously consumed bytes + offset was all the data - none or corrupt payload */ { - /* Error condition */ + if (check_col(g_cinfo, COL_INFO)) + { + col_set_str(g_cinfo, COL_INFO, "Invalid Packet Length from LRH! [Malformed Packet]"); + col_set_fence(g_cinfo, COL_INFO); + } return; } + if(virtualLane == 0xF0) + { + management_class = tvb_get_guint8(tvb, (*offset) + 1); + + if(((management_class >= (guint8)VENDOR_1_START) && (management_class <= (guint8)VENDOR_1_END)) + || ((management_class >= (guint8)VENDOR_2_START) && (management_class <= (guint8)VENDOR_2_END))) + { + /* parse vendor specific */ + parse_VENDOR_MANAGEMENT(parentTree, tvb, offset); + } + else if((management_class >= (guint8)APPLICATION_START) && (management_class <= (guint8)APPLICATION_END)) + { + /* parse application specific */ + parse_APPLICATION_MANAGEMENT(parentTree, tvb, offset); + } + else if(((management_class == (guint8)0x00) || (management_class == (guint8)0x02)) + || ((management_class >= (guint8)0x50) && (management_class <= (guint8)0x80)) + || ((management_class >= (guint8)0x82))) + { + /* parse reserved classes */ + parse_RESERVED_MANAGEMENT(parentTree, tvb, offset); + } + else /* we have a normal management_class */ + { + switch(management_class) + { + case SUBN_LID_ROUTED: + /* parse subn man lid routed */ + parse_SUBN_LID_ROUTED(parentTree, tvb, &local_offset); + break; + case SUBN_DIRECTED_ROUTE: + /* parse subn directed route */ + parse_SUBN_DIRECTED_ROUTE(parentTree, tvb, &local_offset); + break; + case SUBNADMN: + /* parse sub admin */ + parse_SUBNADMN(parentTree, tvb, &local_offset); + break; + case PERF: + /* parse performance */ + parse_PERF(parentTree, tvb, &local_offset); + break; + case BM: + /* parse baseboard mgmt */ + parse_BM(parentTree, tvb, &local_offset); + break; + case DEV_MGT: + /* parse device management */ + parse_DEV_MGT(parentTree, tvb, &local_offset); + break; + case COM_MGT: + /* parse communication management */ + parse_COM_MGT(parentTree, tvb, &local_offset); + break; + case SNMP: + /* parse snmp tunneling */ + parse_SNMP(parentTree, tvb, &local_offset); + break; + default: + break; + } + } + } + else /* Normal Data Packet - Parse as such */ + { + /* Calculation for Payload: + * (tvb->length) Length of entire packet - (local_offset) Starting byte of Payload Data + * offset addition is more complex for the payload. + * We need the total length of the packet, - length of previous headers, + offset where payload started. + * We also need to reserve 6 bytes for the CRCs which are not actually part of the payload. */ + + /* IBA packet data could be anything in principle, however it is common + * practice to carry non-IBA data encapsulated with an EtherType header, + * similar to the RWH header. There is no way to identify these frames + * positively. + * + * We see if the first few bytes look like an EtherType header, and if so + * call the appropriate dissector. If not we call the "data" dissector. + */ + + etype = tvb_get_ntohs(tvb, local_offset); + reserved = tvb_get_ntohs(tvb, local_offset + 2); + + if (reserved == 0) { + + /* Get the captured length and reported length of the data + after the Ethernet type. */ + captured_length = tvb_length_remaining(tvb, local_offset+4); + reported_length = tvb_reported_length_remaining(tvb, + local_offset+4); + + next_tvb = tvb_new_subset(tvb, local_offset+4, captured_length, + reported_length); + + g_pinfo->ethertype = etype; + + /* Look for sub-dissector, and call it if found. + Catch exceptions, so that if the reported length of "next_tvb" + was reduced by some dissector before an exception was thrown, + we can still put in an item for the trailer. */ + saved_proto = g_pinfo->current_proto; + TRY { + dissector_found = dissector_try_port(ethertype_dissector_table, + etype, next_tvb, g_pinfo, top_tree); + } + CATCH(BoundsError) { + /* Somebody threw BoundsError, which means that: + + 1) a dissector was found, so we don't need to + dissect the payload as data or update the + protocol or info columns; + + 2) dissecting the payload found that the packet was + cut off by a snapshot length before the end of + the payload. The trailer comes after the payload, + so *all* of the trailer is cut off, and we'll + just get another BoundsError if we add the trailer. + + Therefore, we just rethrow the exception so it gets + reported; we don't dissect the trailer or do anything + else. */ + RETHROW; + } + CATCH(OutOfMemoryError) { + RETHROW; + } + CATCH_ALL { + /* Somebody threw an exception other than BoundsError, which + means that a dissector was found, so we don't need to + dissect the payload as data or update the protocol or info + columns. We just show the exception and then drive on + to show the trailer, after noting that a dissector was + found and restoring the protocol value that was in effect + before we called the subdissector. */ + show_exception(next_tvb, g_pinfo, top_tree, EXCEPT_CODE, GET_MESSAGE); + dissector_found = TRUE; + g_pinfo->current_proto = saved_proto; + } + ENDTRY; + + if (dissector_found) { + /* now create payload entry to show Ethertype */ + PAYLOAD_header_item = proto_tree_add_item(parentTree, hf_infiniband_payload, tvb, local_offset, tvb_reported_length_remaining(tvb, local_offset)-6, FALSE); + proto_item_set_text(PAYLOAD_header_item, "%s", "IBA Payload - appears to be EtherType encapsulated"); + PAYLOAD_header_tree = proto_item_add_subtree(PAYLOAD_header_item, ett_payload); + proto_tree_add_uint(PAYLOAD_header_tree, hf_infiniband_etype, tvb, + local_offset, 2, tvb_get_ntohs(tvb, local_offset)); - /* Calculation for Payload: */ - /* (tvb->length) Length of entire packet - (local_offset) Starting byte of Payload Data */ - PAYLOAD_header_item = proto_tree_add_item(parentTree, hf_infiniband_payload, tvb, local_offset, (tvb->length) - local_offset, FALSE); local_offset += (tvb->length - 6 - local_offset); - proto_item_set_text(PAYLOAD_header_item, "%s", "Payload"); - PAYLOAD_header_tree = proto_item_add_subtree(PAYLOAD_header_item, ett_infiniband); + local_offset += 2; - /* offset addition is more complex for the payload. */ - /* We need the total length of the packet, - length of previous headers, + offset where payload started. */ - /* We also need to reserve 6 bytes for the CRCs which are not actually part of the payload. */ - proto_tree_add_item(PAYLOAD_header_tree, hf_infiniband_invariant_crc, tvb, local_offset, 4, FALSE); local_offset +=4; - proto_tree_add_item(PAYLOAD_header_tree, hf_infiniband_variant_crc, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_uint(PAYLOAD_header_tree, hf_infiniband_reserved16_RWH, tvb, + local_offset, 2, tvb_get_ntohs(tvb, local_offset)); + + + } else { + tvb_free(next_tvb); + } + + } + + if (!dissector_found) { + /* No sub-dissector found. + Label rest of packet as "Data" */ + + captured_length = tvb_length_remaining(tvb, local_offset); + reported_length = tvb_reported_length_remaining(tvb, + local_offset); + + if (reported_length >= 6) + reported_length -= 6; + if (captured_length > reported_length) + captured_length = reported_length; + + next_tvb = tvb_new_subset(tvb, local_offset, + captured_length, + reported_length); + + call_dissector(data_handle, next_tvb, g_pinfo, top_tree); + + } + + + /*parse_RWH(parentTree, tvb, &local_offset, g_pinfo);*/ + + /* Will contain ICRC and VCRC = 4+2 */ + local_offset = tvb_reported_length(tvb) - 6; + } *offset = local_offset; } -/* Parse VENDOR - Parse a vendor specific or unknown header sequence */ -/* IN: parentTree to add the dissection too - in this code the all_headers_tree */ -/* IN: tvb - the data buffer from wireshark */ -/* IN/OUT: The current and updated offset */ -static void -parse_VENDOR(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) +/* Parse VENDOR - Parse a vendor specific or unknown header sequence +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_VENDOR(proto_tree * parentTree, tvbuff_t *tvb, gint *offset) { gint local_offset = *offset; - /* IETH - Invalidate Extended Transport Header */ proto_tree *VENDOR_header_tree = NULL; proto_item *VENDOR_header_item = NULL; VENDOR_header_item = proto_tree_add_item(parentTree, hf_infiniband_vendor, tvb, local_offset, 4, FALSE); proto_item_set_text(VENDOR_header_item, "%s", "Vendor Specific or Unknown Header Sequence"); - VENDOR_header_tree = proto_item_add_subtree(VENDOR_header_item, ett_infiniband); - + VENDOR_header_tree = proto_item_add_subtree(VENDOR_header_item, ett_vendor); proto_tree_add_item(VENDOR_header_tree, hf_infiniband_vendor, tvb, local_offset, -1, FALSE); + *offset = local_offset; +} + +/* Parse IPv6 - Parse an IPv6 Packet +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_IPvSix(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, packet_info *pinfo) +{ + tvbuff_t *ipv6_tvb; + + if(ipv6_handle == NULL) + { + ipv6_handle = find_dissector("ipv6"); + } + + /* (- 2) for VCRC which lives at the end of the packet */ + ipv6_tvb = tvb_new_subset(tvb, *offset, + tvb_length_remaining(tvb, *offset) - 2, + tvb_reported_length_remaining(tvb, *offset) - 2); + call_dissector(ipv6_handle, ipv6_tvb, pinfo, parentTree); + *offset = tvb_reported_length(tvb) - 2; + + /* Display the VCRC */ + proto_tree_add_item(parentTree, hf_infiniband_variant_crc, tvb, *offset, 2, FALSE); +} + +/* Parse EtherType - Parse a generic IP packaet with an EtherType of IP or ARP +* IN: parentTree to add the dissection to - in this code the all_headers_tree +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_RWH(proto_tree * ah_tree, tvbuff_t *tvb, gint *offset, packet_info *pinfo) +{ + guint16 ether_type; + + /* RWH - Raw Header */ + proto_tree *RWH_header_tree = NULL; + proto_item *RWH_header_item = NULL; + + RWH_header_item = proto_tree_add_item(ah_tree, hf_infiniband_RWH, tvb, *offset, 4, FALSE); + proto_item_set_text(RWH_header_item, "%s", "RWH - Raw Header"); + RWH_header_tree = proto_item_add_subtree(RWH_header_item, ett_rwh); + + ether_type = tvb_get_ntohs(tvb, *offset); + //ether_type = ether_type & 0x0F; /* mask off reserved bits just in case. */ + *offset += 2; + + proto_tree_add_uint(RWH_header_tree, hf_infiniband_reserved16_RWH, tvb, + *offset, 2, tvb_get_ntohs(tvb, *offset)); + + *offset += 2; + + ethertype(ether_type, tvb, *offset, pinfo, top_tree, RWH_header_tree, hf_infiniband_etype, -1, 0); + + *offset = tvb_reported_length(tvb) - 2; + /* Display the VCRC */ + proto_tree_add_item(ah_tree, hf_infiniband_variant_crc, tvb, *offset, 2, FALSE); + +} + +/* Parse Subnet Management (LID Routed) +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_SUBN_LID_ROUTED(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + /* Parse the Common MAD Header */ + MAD_Data MadData; + gint local_offset; + proto_tree *SUBN_LID_ROUTED_header_tree = NULL; + proto_item *SUBN_LID_ROUTED_header_item = NULL; + + if(!parse_MAD_Common(parentTree, tvb, offset, &MadData)) + { + /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */ + return; + } + + local_offset = *offset; + + /* local_offset - 24 here because when we come out of parse_MAD_Common, the offset it sitting at the data section. */ + SUBN_LID_ROUTED_header_item = proto_tree_add_item(parentTree, hf_infiniband_SMP_LID, tvb, local_offset - 24, 256, FALSE); + proto_item_set_text(SUBN_LID_ROUTED_header_item, "%s", "SMP (LID Routed) "); + SUBN_LID_ROUTED_header_tree = proto_item_add_subtree(SUBN_LID_ROUTED_header_item, ett_subn_lid_routed); + proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_m_key, tvb, local_offset, 8, FALSE); local_offset +=8; + proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_reserved256, tvb, local_offset, 32, FALSE); local_offset +=32; + + label_SUBM_Method(SUBN_LID_ROUTED_header_item, &MadData); + label_SUBM_Attribute(SUBN_LID_ROUTED_header_item, &MadData); + + /* Try to do the detail parse of the attribute. If there is an error, or the attribute is unknown, we'll just highlight the generic data. */ + if(!parse_SUBM_Attribute(SUBN_LID_ROUTED_header_tree, tvb, &local_offset, &MadData)) + { + proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); local_offset +=64; + } + + proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_reserved1024, tvb, local_offset, 128, FALSE); local_offset +=128; + *offset = local_offset; +} + +/* Parse Subnet Management (Directed Route) +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_SUBN_DIRECTED_ROUTE(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + /* Parse the Common MAD Header */ + MAD_Data MadData; + gint local_offset; + proto_tree *SUBN_DIRECTED_ROUTE_header_tree = NULL; + proto_item *SUBN_DIRECTED_ROUTE_header_item = NULL; + + if(!parse_MAD_Common(parentTree, tvb, offset, &MadData)) + { + /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */ + return; + } + + local_offset = *offset; + + /* local_offset - 24 here because when we come out of parse_MAD_Common, the offset it sitting at the data section. + * We need to go backwards because this particular SMP uses the class specific portion of the Common MAD Header */ + SUBN_DIRECTED_ROUTE_header_item = proto_tree_add_item(parentTree, hf_infiniband_SMP_DIRECTED, tvb, local_offset - 24, 256, FALSE); + proto_item_set_text(SUBN_DIRECTED_ROUTE_header_item, "%s", "SMP (Directed Route) "); + SUBN_DIRECTED_ROUTE_header_tree = proto_item_add_subtree(SUBN_DIRECTED_ROUTE_header_item, ett_subn_directed_route); + + label_SUBM_Method(SUBN_DIRECTED_ROUTE_header_item, &MadData); + label_SUBM_Attribute(SUBN_DIRECTED_ROUTE_header_item, &MadData); + + /* Place us at offset 4, the "D" Bit (Direction bit for Directed Route SMPs) */ + local_offset -= 20; + proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_d, tvb, local_offset, 1, FALSE); + proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_smp_status, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_hop_pointer, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_hop_count, tvb, local_offset, 1, FALSE); local_offset +=1; + local_offset += 16; /* Skip over the rest of the Common MAD Header... It's already dissected by parse_MAD_Common */ + proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_m_key, tvb, local_offset, 8, FALSE); local_offset +=8; + proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_dr_slid, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_dr_dlid, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_reserved28, tvb, local_offset, 28, FALSE); local_offset +=28; + + /* Try to do the detail parse of the attribute. If there is an error, or the attribute is unknown, we'll just highlight the generic data. */ + if(!parse_SUBM_Attribute(SUBN_DIRECTED_ROUTE_header_tree, tvb, &local_offset, &MadData)) + { + proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); local_offset +=64; + } + + proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_initial_path, tvb, local_offset, 64, FALSE); local_offset +=64; + proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_return_path, tvb, local_offset, 64, FALSE); local_offset +=64; + *offset = local_offset; +} + +/* Parse Subnet Administration +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_SUBNADMN(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + /* Parse the Common MAD Header */ + MAD_Data MadData; + gint local_offset; + proto_tree *SUBNADMN_header_tree = NULL; + proto_item *SUBNADMN_header_item = NULL; + + if(!parse_MAD_Common(parentTree, tvb, offset, &MadData)) + { + /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */ + return; + } + if(!parse_RMPP(parentTree, tvb, offset)) + { + /* TODO: Mark Corrupt Packet */ + return; + } + local_offset = *offset; + + SUBNADMN_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset - 36, 256, FALSE); + proto_item_set_text(SUBNADMN_header_item, "%s", "SMA"); + SUBNADMN_header_tree = proto_item_add_subtree(SUBNADMN_header_item, ett_subnadmin); + + proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_sm_key, tvb, local_offset, 8, FALSE); local_offset+=8; + proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_attribute_offset, tvb, local_offset, 2, FALSE); local_offset+=4; + proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_reserved16, tvb, local_offset, 2, FALSE); local_offset+=4; + proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_component_mask, tvb, local_offset, 8, FALSE); local_offset+=8; + + label_SUBA_Method(SUBNADMN_header_item, &MadData); + label_SUBA_Attribute(SUBNADMN_header_item, &MadData); + + if(!parse_SUBA_Attribute(SUBNADMN_header_tree, tvb, &local_offset, &MadData)) + { + proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_subnet_admin_data, tvb, local_offset, 200, FALSE); local_offset+=200; + } + *offset = local_offset; +} + +/* Parse Performance Management +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_PERF(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + /* Parse the Common MAD Header */ + MAD_Data MadData; + gint local_offset; + proto_item *PERF_header_item = NULL; + + if(!parse_MAD_Common(parentTree, tvb, offset, &MadData)) + { + /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */ + return; + } + local_offset = *offset; + PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256; + proto_item_set_text(PERF_header_item, "%s", "PERF - Performance Management MAD (Dissector Not Implemented)"); + *offset = local_offset; +} + +/* Parse Baseboard Management +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_BM(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + /* Parse the Common MAD Header */ + MAD_Data MadData; + gint local_offset; + proto_item *PERF_header_item = NULL; + + if(!parse_MAD_Common(parentTree, tvb, offset, &MadData)) + { + /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */ + return; + } + local_offset = *offset; + + PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256; + proto_item_set_text(PERF_header_item, "%s", "BM - Baseboard Management MAD (Dissector Not Implemented)"); + *offset = local_offset; +} + +/* Parse Device Management +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_DEV_MGT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + /* Parse the Common MAD Header */ + MAD_Data MadData; + gint local_offset; + proto_item *PERF_header_item = NULL; + + if(!parse_MAD_Common(parentTree, tvb, offset, &MadData)) + { + /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */ + return; + } + local_offset = *offset; + PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256; + proto_item_set_text(PERF_header_item, "%s", "DEV_MGT - Device Management MAD (Dissector Not Implemented)"); + *offset = local_offset; +} + +/* Parse Communications Management +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_COM_MGT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + /* Parse the Common MAD Header */ + MAD_Data MadData; + gint local_offset; + proto_item *PERF_header_item = NULL; + + if(!parse_MAD_Common(parentTree, tvb, offset, &MadData)) + { + /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */ + return; + } + local_offset = *offset; + PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256; + proto_item_set_text(PERF_header_item, "%s", "COMM - Communication Management MAD (Dissector Not Implemented)"); + *offset = local_offset; +} + +/* Parse SNMP Tunneling +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_SNMP(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + /* Parse the Common MAD Header */ + MAD_Data MadData; + gint local_offset; + proto_item *PERF_header_item = NULL; + + if(!parse_MAD_Common(parentTree, tvb, offset, &MadData)) + { + /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */ + return; + } + local_offset = *offset; + + PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256; + proto_item_set_text(PERF_header_item, "%s", "SNMP - SNMP Tunneling MAD (Dissector Not Implemented)"); + *offset = local_offset; +} + +/* Parse Vendor Specific Management Packets +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_VENDOR_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + /* Parse the Common MAD Header */ + MAD_Data MadData; + gint local_offset; + proto_item *PERF_header_item = NULL; + + if(!parse_MAD_Common(parentTree, tvb, offset, &MadData)) + { + /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */ + return; + } + local_offset = *offset; + + PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256; + proto_item_set_text(PERF_header_item, "%s", "VENDOR - Vendor Specific Management MAD (Dissector Not Implemented)"); + *offset = local_offset; +} + +/* Parse Application Specific Management Packets +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_APPLICATION_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + /* Parse the Common MAD Header */ + MAD_Data MadData; + gint local_offset; + proto_item *PERF_header_item = NULL; + + if(!parse_MAD_Common(parentTree, tvb, offset, &MadData)) + { + /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */ + return; + } + local_offset = *offset; + PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256; + proto_item_set_text(PERF_header_item, "%s", "APP - Application Specific MAD (Dissector Not Implemented)"); + *offset = local_offset; +} + +/* Parse Reserved Management Packets. + +* This is an !ERROR CONDITION! +* It means that the Management Class value used was defined as a reserved value for furture use. +* This method is here since we will want to report this information directly to the UI without blowing up Wireshark. + +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static void parse_RESERVED_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + /* Parse the Common MAD Header */ + MAD_Data MadData; + gint local_offset; + proto_item *PERF_header_item = NULL; + + if(!parse_MAD_Common(parentTree, tvb, offset, &MadData)) + { + /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */ + return; + } + local_offset = *offset; + PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256; + proto_item_set_text(PERF_header_item, "%s", "RESERVED - Reserved MAD Type (Possible Device Error)"); + *offset = local_offset; +} + +/* Parse the common MAD Header +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset +* IN/OUT: MadData - the data from the MAD header */ +static gboolean parse_MAD_Common(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data* MadData) +{ + gint local_offset = *offset; + proto_tree *MAD_header_tree = NULL; + proto_item *MAD_header_item = NULL; + + if(MadData == NULL) + return FALSE; + if(!tvb_bytes_exist(tvb, *offset, 256)) + return FALSE; + + /* Get the Management Class to decide between LID Routed and Direct Route */ + MadData->managementClass = tvb_get_guint8(tvb, local_offset + 1); + MadData->classVersion = tvb_get_guint8(tvb, local_offset + 2); + MadData->method = tvb_get_guint8(tvb, local_offset + 3); + MadData->status = tvb_get_guint8(tvb, local_offset + 4); + MadData->classSpecific = tvb_get_ntohs(tvb, local_offset + 6); + MadData->transactionID = tvb_get_ntoh64(tvb, local_offset + 8); + MadData->attributeID = tvb_get_ntohs(tvb, local_offset + 16); + MadData->attributeModifier = tvb_get_ntohl(tvb, local_offset + 20); + tvb_memcpy(tvb, MadData->data, local_offset + 24, 232); + + /* Populate the Dissector Tree */ + + MAD_header_item = proto_tree_add_item(parentTree, hf_infiniband_MAD, tvb, local_offset, 256, FALSE); + proto_item_set_text(MAD_header_item, "%s", "MAD Header - Common Management Datagram"); + MAD_header_tree = proto_item_add_subtree(MAD_header_item, ett_mad); + + proto_tree_add_item(MAD_header_tree, hf_infiniband_base_version, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MAD_header_tree, hf_infiniband_mgmt_class, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MAD_header_tree, hf_infiniband_class_version, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MAD_header_tree, hf_infiniband_method, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MAD_header_tree, hf_infiniband_status, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(MAD_header_tree, hf_infiniband_class_specific, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(MAD_header_tree, hf_infiniband_transaction_id, tvb, local_offset, 8, FALSE); local_offset+=8; + proto_tree_add_item(MAD_header_tree, hf_infiniband_attribute_id, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(MAD_header_tree, hf_infiniband_reserved16, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(MAD_header_tree, hf_infiniband_attribute_modifier, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(MAD_header_tree, hf_infiniband_data, tvb, local_offset, 232, FALSE); local_offset+=232; + *offset = (local_offset - 232); /* Move the offset back to the start of the Data field - this will be where the other parsers start. */ + + return TRUE; +} + +/* Parse the RMPP (Reliable Multi-Packet Transaction Protocol +* IN: parentTree to add the dissection to +* IN: tvb - the data buffer from wireshark +* IN/OUT: The current and updated offset */ +static gboolean parse_RMPP(proto_tree *parentTree, tvbuff_t *tvb, gint *offset) +{ + gint local_offset = *offset; + guint8 RMPP_Type = tvb_get_guint8(tvb, local_offset + 1); + proto_tree *RMPP_header_tree = NULL; + proto_item *RMPP_header_item = NULL; + + RMPP_header_item = proto_tree_add_item(parentTree, hf_infiniband_RMPP, tvb, local_offset, 12, FALSE); + proto_item_set_text(RMPP_header_item, "%s", val_to_str(RMPP_Type, RMPP_Packet_Types, "Reserved RMPP Type! (0x%02x)")); + RMPP_header_tree = proto_item_add_subtree(RMPP_header_item, ett_rmpp); + + proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_version, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_type, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(RMPP_header_tree, hf_infiniband_r_resp_time, tvb, local_offset, 1, FALSE); + proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_flags, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_status, tvb, local_offset, 1, FALSE); local_offset+=1; + switch(RMPP_Type) + { + case RMPP_ILLEGAL: + proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_data1, tvb, local_offset, 32, FALSE); local_offset+=32; + proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_data2, tvb, local_offset, 32, FALSE); local_offset+=32; + break; + case RMPP_DATA: + proto_tree_add_item(RMPP_header_tree, hf_infiniband_segment_number, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(RMPP_header_tree, hf_infiniband_payload_length32, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(RMPP_header_tree, hf_infiniband_transferred_data, tvb, local_offset, 220, FALSE); + break; + case RMPP_ACK: + proto_tree_add_item(RMPP_header_tree, hf_infiniband_segment_number, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(RMPP_header_tree, hf_infiniband_new_window_last, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved220, tvb, local_offset, 220, FALSE); + break; + case RMPP_STOP: + case RMPP_ABORT: + proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved32, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved32, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(RMPP_header_tree, hf_infiniband_optional_extended_error_data, tvb, local_offset, 220, FALSE); + break; + default: + break; + } + *offset = local_offset; + return TRUE; +} + +/* Parse the Method from the MAD Common Header. +* Simply used to generate the identifier. +* IN: SubMItem - the item to append the method label to. +* IN: MadHeader - the MadData structure that contains the information from the Common MAD header. */ +static void label_SUBM_Method(proto_item *SubMItem, MAD_Data *MadHeader) +{ + switch(MadHeader->method) + { + case 0x01: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "SubnGet("); + } + col_append_str(g_cinfo, COL_INFO, "SubnGet("); + break; + case 0x02: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "SubnSet("); + } + col_append_str(g_cinfo, COL_INFO, "SubnSet("); + break; + case 0x81: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "SubnGetResp("); + } + col_append_str(g_cinfo, COL_INFO, "SubnGetResp("); + break; + case 0x05: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "SubnTrap("); + } + col_append_str(g_cinfo, COL_INFO, "SubnTrap("); + break; + case 0x07: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "SubnTrapResp("); + } + col_append_str(g_cinfo, COL_INFO, "SubnTrapResp("); + break; + default: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "Unknown SubManagement Method!"); + } + col_append_str(g_cinfo, COL_INFO, "Unknown SubManagement Method!"); + break; + } +} +/* Parse the SA Method from the MAD Common Header. +* Simply used to generate the identifier. +* IN: SubAItem - the item to append the method label to. +* IN: MadHeader - the MadData structure that contains the information from the Common MAD header. */ +static void label_SUBA_Method(proto_item *SubAItem, MAD_Data *MadHeader) +{ + switch(MadHeader->method) + { + case 0x01: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmGet("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmGet("); + break; + case 0x81: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmGetResp("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmGetResp("); + break; + case 0x02: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmSet("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmSet("); + break; + case 0x06: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmReport("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmReport("); + break; + case 0x86: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmReportResp("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmReportResp("); + break; + case 0x12: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmGetTable("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmGetTable("); + break; + case 0x92: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmGetTableResp("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmGetTableResp("); + break; + case 0x13: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmGetTraceTable("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmGetTraceTable("); + break; + case 0x14: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmGetMulti("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmGetMulti("); + break; + case 0x94: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmGetMultiResp("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmGetMultiResp("); + break; + case 0x15: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmDelete("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmDelete("); + break; + case 0x95: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "SubnAdmDeleteResp("); + } + col_append_str(g_cinfo, COL_INFO, "SubnAdmDeleteResp("); + break; + default: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", "Unknown SubAdministration Method!"); + } + col_append_str(g_cinfo, COL_INFO, "Unknown SubAdministration Method!"); + break; + } +} + +/* Parse the Attribute from the MAD Common Header +* Simply used to generate the identifier. +* IN: SubMItem - the item to append the Attribute label to. +* IN: MadHeader - the MadData structure that contains the information from the Common MAD header. */ +static void label_SUBM_Attribute(proto_item *SubMItem, MAD_Data *MadHeader) +{ + switch(MadHeader->attributeID) + { + case 0x0002: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "Notice) "); + } + col_append_str(g_cinfo, COL_INFO, "Notice)"); + break; + case 0x0010: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "NodeDescription) "); + } + col_append_str(g_cinfo, COL_INFO, "NodeDescription)"); + break; + case 0x0011: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "NodeInfo) "); + } + col_append_str(g_cinfo, COL_INFO, "NodeInfo)"); + break; + case 0x0012: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "SwitchInfo) "); + } + col_append_str(g_cinfo, COL_INFO, "SwitchInfo)"); + break; + case 0x0014: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "GUIDInfo) "); + } + col_append_str(g_cinfo, COL_INFO, "GUIDInfo)"); + break; + case 0x0015: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "PortInfo) "); + } + col_append_str(g_cinfo, COL_INFO, "PortInfo)"); + break; + case 0x0016: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "P_KeyTable) "); + } + col_append_str(g_cinfo, COL_INFO, "P_KeyTable)"); + break; + case 0x0017: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "SLtoVLMappingTable) "); + } + col_append_str(g_cinfo, COL_INFO, "SLtoVLMappingTable)"); + break; + case 0x0018: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "VLArbitrationTable) "); + } + col_append_str(g_cinfo, COL_INFO, "VLArbitrationTable)"); + break; + case 0x0019: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "LinearForwardingTable) "); + } + col_append_str(g_cinfo, COL_INFO, "LinearForwardingTable)"); + break; + case 0x001A: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "RandomForwardingTable) "); + } + col_append_str(g_cinfo, COL_INFO, "RandomForwardingTable)"); + break; + case 0x001B: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "MulticastForwardingTable) "); + } + col_append_str(g_cinfo, COL_INFO, "MulticastForwardingTable)"); + break; + case 0x001C: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "LinkSpeedWidthPairsTable) "); + } + col_append_str(g_cinfo, COL_INFO, "LinkSpeedWidthPairsTable)"); + break; + case 0x0020: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "SMinfo) "); + } + col_append_str(g_cinfo, COL_INFO, "SMinfo)"); + break; + case 0x0030: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "VendorDiag) "); + } + col_append_str(g_cinfo, COL_INFO, "VendorDiag)"); + break; + case 0x0031: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", "LedInfo) "); + } + col_append_str(g_cinfo, COL_INFO, "LedInfo)"); + break; + default: + if(SubMItem) + { + proto_item_append_text(SubMItem, "%s", " (Unknown SubManagement Attribute!) "); + } + col_append_str(g_cinfo, COL_INFO, "(Unknown SubManagement Attribute!)"); + break; + } +} + +/* Parse the SA Attribute from the MAD Common Header +* Simply used to generate the identifier. +* IN: SubAItem - the item to append the Attribute label to. +* IN: MadHeader - the MadData structure that contains the information from the Common MAD header. */ +static void label_SUBA_Attribute(proto_item *SubAItem, MAD_Data *MadHeader) +{ + switch(MadHeader->attributeID) + { + case 0x0001: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (ClassPortInfo) "); + } + col_append_str(g_cinfo, COL_INFO, "(ClassPortInfo)"); + break; + case 0x0002: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (Notice) "); + } + col_append_str(g_cinfo, COL_INFO, "(Notice)"); + break; + case 0x0003: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (InformInfo) "); + } + col_append_str(g_cinfo, COL_INFO, "(InformInfo)"); + break; + case 0x0011: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (NodeRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(NodeRecord)"); + break; + case 0x0012: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (PortInfoRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(PortInfoRecord)"); + break; + case 0x0013: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (SLtoVLMappingTableRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(SLtoVLMappingTableRecord)"); + break; + case 0x0014: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (SwitchInfoRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(SwitchInfoRecord)"); + break; + case 0x0015: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (LinearForwardingTableRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(LinearForwardingTableRecord)"); + break; + case 0x0016: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (RandomForwardingTableRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(RandomForwardingTableRecord)"); + break; + case 0x0017: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (MulticastForwardingTableRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(MulticastForwardingTableRecord)"); + break; + case 0x0018: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (SMInfoRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(SMInfoRecord)"); + break; + case 0x0019: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (LinkSpeedWidthPairsTableRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(LinkSpeedWidthPairsTableRecord)"); + break; + case 0x00F3: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (InformInfoRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(InformInfoRecord)"); + break; + case 0x0020: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (LinkRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(LinkRecord)"); + break; + case 0x0030: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (GuidInfoRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(GuidInfoRecord)"); + break; + case 0x0031: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (ServiceRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(ServiceRecord)"); + break; + case 0x0033: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (P_KeyTableRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(P_KeyTableRecord)"); + break; + case 0x0035: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (PathRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(PathRecord)"); + break; + case 0x0036: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (VLArbitrationTableRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(VLArbitrationTableRecord)"); + break; + case 0x0038: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (MCMemberRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(MCMemberRecord)"); + break; + case 0x0039: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (TraceRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(TraceRecord)"); + break; + case 0x003A: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (MultiPathRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(MultiPathRecord)"); + break; + case 0x003B: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (ServiceAssociationRecord) "); + } + col_append_str(g_cinfo, COL_INFO, "(ServiceAssociationRecord)"); + break; + default: + if(SubAItem) + { + proto_item_append_text(SubAItem, "%s", " (Unknown SubAdministration Attribute!) "); + } + col_append_str(g_cinfo, COL_INFO, "(Unknown SubAdministration Attribute!)"); + break; + } +} + +/* Parse the attribute from a Subnet Management Packet. +* IN: Parent Tree to add the item to in the dissection tree +* IN: tvbuff, offset - the data and where it is. +* IN: MAD_Data the data from the Common MAD Header that provides the information we need */ +static gboolean parse_SUBM_Attribute(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data *MadHeader) +{ + guint16 attributeID = MadHeader->attributeID; + proto_tree *SUBM_Attribute_header_tree = NULL; + proto_item *SUBM_Attribute_header_item = NULL; + + SUBM_Attribute_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, *offset, 64, FALSE); + proto_item_set_text(SUBM_Attribute_header_item, "%s", val_to_str(attributeID, SUBM_Attributes, "Unknown Attribute Type! (0x%02x)")); + SUBM_Attribute_header_tree = proto_item_add_subtree(SUBM_Attribute_header_item, ett_subm_attribute); + + + switch(attributeID) + { + case 0x0002: + parse_NoticesAndTraps(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0010: + parse_NodeDescription(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0011: + parse_NodeInfo(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0012: + parse_SwitchInfo(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0014: + parse_GUIDInfo(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0015: + parse_PortInfo(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0016: + parse_P_KeyTable(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0017: + parse_SLtoVLMappingTable(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0018: + parse_VLArbitrationTable(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0019: + parse_LinearForwardingTable(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x001A: + parse_RandomForwardingTable(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x001B: + parse_MulticastForwardingTable(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x001C: + parse_SMInfo(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0020: + parse_VendorDiag(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0030: + parse_LedInfo(SUBM_Attribute_header_tree , tvb, offset); + break; + case 0x0031: + parse_LinkSpeedWidthPairsTable(SUBM_Attribute_header_tree , tvb, offset); + break; + default: + break; + } + + + *offset += 64; + return TRUE; + +} +/* Parse the attribute from a Subnet Administration Packet. +* IN: Parent Tree to add the item to in the dissection tree +* IN: tvbuff, offset - the data and where it is. +* IN: MAD_Data the data from the Common MAD Header that provides the information we need */ +static gboolean parse_SUBA_Attribute(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data *MadHeader) +{ + guint16 attributeID = MadHeader->attributeID; + proto_tree *SUBA_Attribute_header_tree = NULL; + proto_item *SUBA_Attribute_header_item = NULL; + + SUBA_Attribute_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, *offset, 200, FALSE); + proto_item_set_text(SUBA_Attribute_header_item, "%s", val_to_str(attributeID, SUBA_Attributes, "Unknown Attribute Type! (0x%02x)")); + SUBA_Attribute_header_tree = proto_item_add_subtree(SUBA_Attribute_header_item, ett_suba_attribute); + + /* Skim off the RID fields should they be present */ + parse_RID(SUBA_Attribute_header_tree, tvb, offset, MadHeader); + + /* Parse the rest of the attributes */ + switch(MadHeader->attributeID) + { + case 0x0001: /* (ClassPortInfo) */ + parse_PortInfo(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0002: /* (Notice) */ + parse_NoticesAndTraps(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0003: /* (InformInfo) */ + parse_InformInfo(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0011: /* (NodeRecord) */ + parse_NodeInfo(SUBA_Attribute_header_tree, tvb, offset); + *offset += 40; + parse_NodeDescription(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0012: /* (PortInfoRecord) */ + parse_PortInfo(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0013: /* (SLtoVLMappingTableRecord) */ + parse_SLtoVLMappingTable(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0014: /* (SwitchInfoRecord) */ + parse_SwitchInfo(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0015: /*(LinearForwardingTableRecord) */ + parse_LinearForwardingTable(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0016: /* (RandomForwardingTableRecord) */ + parse_RandomForwardingTable(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0017: /* (MulticastForwardingTableRecord) */ + parse_MulticastForwardingTable(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0018: /* (SMInfoRecord) */ + parse_SMInfo(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0019: /* (LinkSpeedWidthPairsTableRecord) */ + parse_LinkSpeedWidthPairsTable(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x00F3: /*(InformInfoRecord) */ + parse_InformInfo(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0020: /* (LinkRecord) */ + parse_LinkRecord(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0030: /* (GuidInforecord) */ + parse_GUIDInfo(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0031: /*(ServiceRecord) */ + parse_ServiceRecord(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0033: /* (P_KeyTableRecord) */ + parse_P_KeyTable(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0035: /* (PathRecord) */ + parse_PathRecord(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0036: /* (VLArbitrationTableRecord) */ + parse_VLArbitrationTable(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0038: /* (MCMemberRecord) */ + parse_MCMemberRecord(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x0039: /* (TraceRecord) */ + parse_TraceRecord(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x003A: /* (MultiPathRecord) */ + parse_MultiPathRecord(SUBA_Attribute_header_tree, tvb, offset); + break; + case 0x003B: /* (ServiceAssociationRecord) */ + parse_ServiceAssociationRecord(SUBA_Attribute_header_tree, tvb, offset); + break; + default: /* (Unknown SubAdministration Attribute!) */ + /* We've already labeled as unknown in item construction */ + break; + } + + *offset += 200; + return TRUE; +} + +/* Subnet Management Attribute Parsing Methods. +* Also Parsing for Attributes common to both SM/SA. +* The Subnet Admin Parsing methods will call some of these methods when an attribute is present within an SA MAD +*/ + + +/* Parse NoticeDataDetails Attribute Field +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* trapNumber - The Trap ID of the Trap Data being Dissected */ + +static void parse_NoticeDataDetails(proto_tree* parentTree, tvbuff_t* tvb, gint *offset, guint16 trapNumber) +{ + gint local_offset = *offset; + proto_tree *DataDetails_header_tree = NULL; + proto_item *DataDetails_header_item = NULL; + + if(!parentTree) + return; + + DataDetails_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 54, FALSE); + DataDetails_header_tree = proto_item_add_subtree(DataDetails_header_item, ett_datadetails); + + + switch(trapNumber) + { + case 64: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 64 DataDetails"); + local_offset +=6; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16; + break; + case 65: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 65 DataDetails"); + local_offset +=6; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16; + break; + case 66: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 66 DataDetails"); + local_offset +=6; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16; + break; + case 67: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 67 DataDetails"); + local_offset +=6; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR, tvb, local_offset, 16, FALSE); local_offset+=16; + break; + case 68: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 68 DataDetails"); + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_COMP_MASK, tvb, local_offset, 8, FALSE); local_offset+=8; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_WAIT_FOR_REPATH, tvb, local_offset, 1, FALSE); + break; + case 69: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 69 DataDetails"); + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_COMP_MASK, tvb, local_offset, 8, FALSE); local_offset+=8; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_WAIT_FOR_REPATH, tvb, local_offset, 1, FALSE); + break; + case 128: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 128 DataDetails"); + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2; + break; + case 129: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 129 DataDetails"); + local_offset += 2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1; + break; + case 130: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 130 DataDetails"); + local_offset += 2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1; + break; + case 131: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 131 DataDetails"); + local_offset += 2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1; + break; + case 144: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 144 DataDetails"); + local_offset +=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset +=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_OtherLocalChanges, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_CAPABILITYMASK, tvb, local_offset, 4, FALSE); local_offset+=4; + local_offset +=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LinkSpeecEnabledChange, tvb, local_offset, 1, FALSE); + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LinkWidthEnabledChange, tvb, local_offset, 1, FALSE); + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_NodeDescriptionChange, tvb, local_offset, 1, FALSE); + break; + case 145: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 145 DataDetails"); + local_offset +=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset +=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SYSTEMIMAGEGUID, tvb, local_offset, 8, FALSE); local_offset+=8; + break; + case 256: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 256 DataDetails"); + local_offset +=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRSLID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_METHOD, tvb, local_offset, 1, FALSE); local_offset+=1; + local_offset +=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_ATTRIBUTEID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_ATTRIBUTEMODIFIER, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_MKEY, tvb, local_offset, 8, FALSE); local_offset+=8; + local_offset +=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRNotice, tvb, local_offset, 1, FALSE); + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRPathTruncated, tvb, local_offset, 1, FALSE); + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRHopCount, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRNoticeReturnPath, tvb, local_offset, 30, FALSE); local_offset+=30; + break; + case 257: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 257 DataDetails"); + local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_KEY, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, FALSE); + local_offset +=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, FALSE); local_offset+=3; + local_offset +=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, FALSE); local_offset+=3; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, FALSE); local_offset+=16; + break; + case 258: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 258 DataDetails"); + local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_KEY, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, FALSE); + local_offset +=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, FALSE); local_offset+=3; + local_offset +=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, FALSE); local_offset+=3; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, FALSE); local_offset+=16; + break; + case 259: + proto_item_set_text(DataDetails_header_item, "%s", "Trap 259 DataDetails"); + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DataValid, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PKEY, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL, tvb, local_offset, 1, FALSE); + local_offset +=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1, tvb, local_offset, 3, FALSE); local_offset+=3; + local_offset +=1; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2, tvb, local_offset, 3, FALSE); local_offset+=3; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SWLIDADDR, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO, tvb, local_offset, 1, FALSE); local_offset+=1; + break; + default: + proto_item_set_text(DataDetails_header_item, "%s", "Vendor Specific Subnet Management Trap"); local_offset +=54; + break; + } + +} + +/* Parse NoticesAndTraps Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_NoticesAndTraps(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *NoticesAndTraps_header_tree = NULL; + proto_item *NoticesAndTraps_header_item = NULL; + guint16 trapNumber = tvb_get_ntohs(tvb, local_offset + 4); + + if(!parentTree) + return; + + NoticesAndTraps_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); + proto_item_set_text(NoticesAndTraps_header_item, "%s", val_to_str(trapNumber, Trap_Description, "Unknown or Vendor Specific Trap Number! (0x%02x)")); + NoticesAndTraps_header_tree = proto_item_add_subtree(NoticesAndTraps_header_item, ett_noticestraps); + + proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IsGeneric, tvb, local_offset, 1, FALSE); + proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_Type, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_ProducerTypeVendorID, tvb, local_offset, 3, FALSE); local_offset+=3; + proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_TrapNumberDeviceID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IssuerLID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_NoticeToggle, tvb, local_offset, 1, FALSE); + proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_NoticeCount, tvb, local_offset, 2, FALSE); local_offset+=2; + + parse_NoticeDataDetails(NoticesAndTraps_header_tree, tvb, &local_offset, trapNumber); + proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_DataDetails, tvb, local_offset, 54, FALSE); local_offset+=54; + + /* Only Defined For GMPs not SMPs which is not part of this dissector phase + *proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IssuerGID, tvb, local_offset, 16, FALSE); local_offset+=16; + *proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_ClassTrapSpecificData, tvb, local_offset, 1, FALSE); local_offset+=1; */ + +} + +/* Parse NodeDescription Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_NodeDescription(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *NodeDescription_header_tree = NULL; + + if(!parentTree) + return; + + NodeDescription_header_tree = parentTree; + proto_tree_add_item(NodeDescription_header_tree, hf_infiniband_NodeDescription_NodeString, tvb, local_offset, 64, FALSE); +} + +/* Parse NodeInfo Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_NodeInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *NodeInfo_header_tree = NULL; + + if(!parentTree) + return; + + NodeInfo_header_tree = parentTree; + + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_BaseVersion, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_ClassVersion, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NodeType, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NumPorts, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_SystemImageGUID, tvb, local_offset, 8, FALSE); local_offset +=8; + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NodeGUID, tvb, local_offset, 8, FALSE); local_offset +=8; + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_PortGUID, tvb, local_offset, 8, FALSE); local_offset +=8; + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_PartitionCap, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_DeviceID, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_Revision, tvb, local_offset, 4, FALSE); local_offset +=4; + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_LocalPortNum, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_VendorID, tvb, local_offset, 3, FALSE); local_offset +=3; + +} + +/* Parse SwitchInfo Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_SwitchInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *SwitchInfo_header_tree = NULL; + + if(!parentTree) + return; + + SwitchInfo_header_tree = parentTree; + + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LinearFDBCap, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_RandomFDBCap, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_MulticastFDBCap, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LinearFDBTop, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultPort, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LifeTimeValue, tvb, local_offset, 1, FALSE); + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_PortStateChange, tvb, local_offset, 1, FALSE); + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LIDsPerPort, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_PartitionEnforcementCap, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_InboundEnforcementCap, tvb, local_offset, 1, FALSE); + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_OutboundEnforcementCap, tvb, local_offset, 1, FALSE); + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_FilterRawInboundCap, tvb, local_offset, 1, FALSE); + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_FilterRawOutboundCap, tvb, local_offset, 1, FALSE); + proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_EnhancedPortZero, tvb, local_offset, 1, FALSE); local_offset +=1; +} + +/* Parse GUIDInfo Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_GUIDInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *GUIDInfo_header_tree = NULL; + proto_item *tempItemLow = NULL; + gint i = 0; + + if(!parentTree) + return; + + GUIDInfo_header_tree = parentTree; + + for(i = 0; i < 8; i++) + { + proto_tree_add_item(GUIDInfo_header_tree, hf_infiniband_GUIDInfo_GUID, tvb, local_offset, 8, FALSE); local_offset +=8; + proto_item_append_text(tempItemLow, "(%u)", i); + } + +} + +/* Parse PortInfo Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_PortInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *PortInfo_header_tree = NULL; + proto_tree *PortInfo_CapabilityMask_tree = NULL; + proto_item *PortInfo_CapabilityMask_item = NULL; + proto_item *temp_item = NULL; + guint16 temp_val = 0; + + if(!parentTree) + return; + + PortInfo_header_tree = parentTree; + + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_Key, tvb, local_offset, 8, FALSE); local_offset +=8; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_GidPrefix, tvb, local_offset, 8, FALSE); local_offset +=8; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LID, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MasterSMLID, tvb, local_offset, 2, FALSE); local_offset +=2; + + /* Capability Mask Flags */ + PortInfo_CapabilityMask_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_CapabilityMask, tvb, local_offset, 4, FALSE); + PortInfo_CapabilityMask_tree = proto_item_add_subtree(PortInfo_CapabilityMask_item, ett_portinfo_capmask); + + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SM, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_NoticeSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_TrapSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SMdisabled, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_ReinitSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported, tvb, local_offset, 4, FALSE); + proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported, tvb, local_offset, 4, FALSE); + local_offset+=4; + /* End Capability Mask Flags */ + + /* Diag Code */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_DiagCode, tvb, local_offset, 2, FALSE); + temp_val = tvb_get_ntohs(tvb, local_offset); + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, DiagCode, "Reserved DiagCode! Possible Error")); + local_offset +=2; + /* End Diag Code */ + + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyLeasePeriod, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LocalPortNum, tvb, local_offset, 1, FALSE); local_offset +=1; + + /* LinkWidthEnabled */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthEnabled, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthEnabled, "Reserved LinkWidthEnabled Value! Possible Error")); + local_offset +=1; + /* End LinkWidthEnabled */ + + /* LinkWidthSupported */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthSupported, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthSupported, "Reserved LinkWidthSupported Value! Possible Error")); + local_offset +=1; + /* End LinkWidthSupported */ + + /* LinkWidthActive */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthActive, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthActive, "Reserved LinkWidthActive Value! Possible Error")); + local_offset +=1; + /* End LinkWidthActive */ + + /* LinkSpeedSupported */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedSupported, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + /* 4 bit values = mask and shift */ + temp_val = temp_val & 0x00F0; + temp_val = temp_val >> 4; + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedSupported, "Reserved LinkWidthSupported Value! Possible Error")); + /* End LinkSpeedSupported */ + + /* PortState */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PortState, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + /* 4 bit values = mask and shift */ + temp_val = temp_val & 0x000F; + /*temp_val = temp_val >> 4 */ + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, PortState, "Reserved PortState Value! Possible Error")); + local_offset +=1; + /* End PortState */ + + /* PortPhysicalState */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PortPhysicalState, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + /* 4 bit values = mask and shift */ + temp_val = temp_val & 0x00F0; + temp_val = temp_val >> 4; + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, PortPhysicalState, "Reserved PortPhysicalState Value! Possible Error")); + /* End PortPhysicalState */ + + /* LinkDownDefaultState */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkDownDefaultState, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + /* 4 bit values = mask and shift */ + temp_val = temp_val & 0x000F; + /*temp_val = temp_val >> 4 */ + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkDownDefaultState, "Reserved LinkDownDefaultState Value! Possible Error")); + local_offset +=1; + /* End LinkDownDefaultState */ + + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyProtectBits, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LMC, tvb, local_offset, 1, FALSE); local_offset +=1; + + /* LinkSpeedActive */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedActive, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + /* 4 bit values = mask and shift */ + temp_val = temp_val & 0x00F0; + temp_val = temp_val >> 4; + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedActive, "Reserved LinkSpeedActive Value! Possible Error")); + /* End LinkSpeedActive */ + + /* LinkSpeedEnabled */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedEnabled, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + /* 4 bit values = mask and shift */ + temp_val = temp_val & 0x000F; + /*temp_val = temp_val >> 4 */ + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedEnabled, "Reserved LinkSpeedEnabled Value! Possible Error")); + local_offset +=1; + /* End LinkSpeedEnabled */ + + /* NeighborMTU */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_NeighborMTU, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + /* 4 bit values = mask and shift */ + temp_val = temp_val & 0x00F0; + temp_val = temp_val >> 4; + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, NeighborMTU, "Reserved NeighborMTU Value! Possible Error")); + + /* End NeighborMTU */ + + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MasterSMSL, tvb, local_offset, 1, FALSE); local_offset +=1; + + /* VLCap */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLCap, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + /* 4 bit values = mask and shift */ + temp_val = temp_val & 0x00F0; + temp_val = temp_val >> 4; + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, VLCap, "Reserved VLCap Value! Possible Error")); + + /* End VLCap */ + + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_InitType, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLHighLimit, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLArbitrationHighCap, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLArbitrationLowCap, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_InitTypeReply, tvb, local_offset, 1, FALSE); + + /* MTUCap */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MTUCap, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + /* 4 bit values = mask and shift */ + temp_val = temp_val & 0x000F; + /*temp_val = temp_val >> 4 */ + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, MTUCap, "Reserved MTUCap Value! Possible Error")); + local_offset +=1; + /* End MTUCap */ + + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLStallCount, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_HOQLife, tvb, local_offset, 1, FALSE); local_offset +=1; + + /* OperationalVLs */ + temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_OperationalVLs, tvb, local_offset, 1, FALSE); + temp_val = (guint16)tvb_get_guint8(tvb, local_offset); + + /* 4 bit values = mask and shift */ + temp_val = temp_val & 0x00F0; + temp_val = temp_val >> 4; + + proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, OperationalVLs, "Reserved OperationalVLs Value! Possible Error")); + /* End OperationalVLs */ + + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PartitionEnforcementInbound, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PartitionEnforcementOutbound, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_FilterRawInbound, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_FilterRawOutbound, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyViolations, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_P_KeyViolations, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_Q_KeyViolations, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_GUIDCap, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_ClientReregister, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_SubnetTimeOut, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_RespTimeValue, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LocalPhyErrors, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_OverrunErrors, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MaxCreditHint, tvb, local_offset, 2, FALSE); local_offset +=3; /* 2 + 1 Reserved */ + proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkRoundTripLatency, tvb, local_offset, 3, FALSE); local_offset +=3; +} + +/* Parse P_KeyTable Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_P_KeyTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + gint i = 0; + proto_tree *P_KeyTable_header_tree = NULL; + proto_item *P_KeyTable_header_item = NULL; + proto_item *tempItemLow = NULL; + proto_item *tempItemHigh = NULL; + + if(!parentTree) + return; + + P_KeyTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_P_KeyTable_P_KeyTableBlock, tvb, local_offset, 64, FALSE); + proto_item_set_text(P_KeyTable_header_item, "%s", "P_KeyTable"); + P_KeyTable_header_tree = proto_item_add_subtree(P_KeyTable_header_item, ett_pkeytable); + + for(i = 0; i < 32; i++) + { + tempItemLow = proto_tree_add_item(P_KeyTable_header_tree, hf_infiniband_P_KeyTable_MembershipType, tvb, local_offset, 1, FALSE); + tempItemHigh = proto_tree_add_item(P_KeyTable_header_tree, hf_infiniband_P_KeyTable_P_KeyBase, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_item_append_text(tempItemLow, "(%u)", i); + proto_item_append_text(tempItemHigh,"(%u)", i+1); + } +} + +/* Parse SLtoVLMappingTable Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_SLtoVLMappingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *SLtoVLMappingTable_header_tree = NULL; + proto_item *SLtoVLMappingTable_header_item = NULL; + proto_item *tempItemLow = NULL; + proto_item *tempItemHigh = NULL; + gint i = 0; + + if(!parentTree) + return; + + SLtoVLMappingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); + proto_item_set_text(SLtoVLMappingTable_header_item, "%s", "SLtoVLMappingTable"); + SLtoVLMappingTable_header_tree = proto_item_add_subtree(SLtoVLMappingTable_header_item, ett_sltovlmapping); + + for(i = 0; i < 8; i++) + { + tempItemLow = proto_tree_add_item(SLtoVLMappingTable_header_tree, hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits, tvb, local_offset, 1, FALSE); + tempItemHigh = proto_tree_add_item(SLtoVLMappingTable_header_tree, hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_item_append_text(tempItemLow, "(%u)", i); + proto_item_append_text(tempItemHigh,"(%u)", i+1); + } +} + +/* Parse VLArbitrationTable Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_VLArbitrationTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + gint i = 0; + proto_tree *VLArbitrationTable_header_tree = NULL; + proto_item *VLArbitrationTable_header_item = NULL; + proto_item *tempItemLow = NULL; + proto_item *tempItemHigh = NULL; + + if(!parentTree) + return; + + VLArbitrationTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); + proto_item_set_text(VLArbitrationTable_header_item, "%s", "VLArbitrationTable"); + VLArbitrationTable_header_tree = proto_item_add_subtree(VLArbitrationTable_header_item, ett_vlarbitrationtable); + + for(i = 0; i < 32; i++) + { + tempItemLow = proto_tree_add_item(VLArbitrationTable_header_tree, hf_infiniband_VLArbitrationTable_VL, tvb, local_offset, 1, FALSE); local_offset +=1; + tempItemHigh = proto_tree_add_item(VLArbitrationTable_header_tree, hf_infiniband_VLArbitrationTable_Weight, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_item_append_text(tempItemLow, "(%u)", i); + proto_item_append_text(tempItemHigh,"(%u)", i); + } +} + +/* Parse LinearForwardingTable Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_LinearForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint i = 0; + gint local_offset = *offset; + proto_tree *LinearForwardingTable_header_tree = NULL; + proto_item *LinearForwardingTable_header_item = NULL; + proto_item *tempItemLow = NULL; + + if(!parentTree) + return; + + LinearForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); + proto_item_set_text(LinearForwardingTable_header_item, "%s", "LinearForwardingTable"); + LinearForwardingTable_header_tree = proto_item_add_subtree(LinearForwardingTable_header_item, ett_linearforwardingtable); + + for(i = 0; i < 64; i++) + { + tempItemLow = proto_tree_add_item(LinearForwardingTable_header_tree, hf_infiniband_LinearForwardingTable_Port, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_item_append_text(tempItemLow, "(%u)", i); + } +} + +/* Parse RandomForwardingTable Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_RandomForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint i = 0; + gint local_offset = *offset; + proto_tree *RandomForwardingTable_header_tree = NULL; + proto_item *RandomForwardingTable_header_item = NULL; + proto_item *tempItemLow = NULL; + + if(!parentTree) + return; + + RandomForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); + proto_item_set_text(RandomForwardingTable_header_item, "%s", "RandomForwardingTable"); + RandomForwardingTable_header_tree = proto_item_add_subtree(RandomForwardingTable_header_item, ett_randomforwardingtable); + + for(i = 0; i < 16; i++) + { + tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_LID, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_item_append_text(tempItemLow, "(%u)", i); + tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_Valid, tvb, local_offset, 1, FALSE); + proto_item_append_text(tempItemLow, "(%u)", i); + tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_LMC, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_item_append_text(tempItemLow, "(%u)", i); + tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_Port, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_item_append_text(tempItemLow, "(%u)", i); + } +} + +/* Parse NoticesAndTraps Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_MulticastForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint i = 0; + gint local_offset = *offset; + proto_tree *MulticastForwardingTable_header_tree = NULL; + proto_item *MulticastForwardingTable_header_item = NULL; + proto_item *tempItemLow = NULL; + + if(!parentTree) + return; + + MulticastForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); + proto_item_set_text(MulticastForwardingTable_header_item, "%s", "MulticastForwardingTable"); + MulticastForwardingTable_header_tree = proto_item_add_subtree(MulticastForwardingTable_header_item, ett_multicastforwardingtable); + + for(i = 0; i < 16; i++) + { + tempItemLow = proto_tree_add_item(MulticastForwardingTable_header_tree, hf_infiniband_MulticastForwardingTable_PortMask, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_item_append_text(tempItemLow, "(%u)", i); + } + +} + +/* Parse SMInfo Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_SMInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *SMInfo_header_tree = NULL; + proto_item *SMInfo_header_item = NULL; + + if(!parentTree) + return; + + SMInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); + proto_item_set_text(SMInfo_header_item, "%s", "SMInfo"); + SMInfo_header_tree = proto_item_add_subtree(SMInfo_header_item, ett_sminfo); + + proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_GUID, tvb, local_offset, 8, FALSE); local_offset +=8; + proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_SM_Key, tvb, local_offset, 8, FALSE); local_offset +=8; + proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_ActCount, tvb, local_offset, 4, FALSE); local_offset +=4; + proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_Priority, tvb, local_offset, 1, FALSE); + proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_SMState, tvb, local_offset, 1, FALSE); local_offset +=1; +} + +/* Parse VendorDiag Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_VendorDiag(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *VendorDiag_header_tree = NULL; + proto_item *VendorDiag_header_item = NULL; + + if(!parentTree) + return; + + VendorDiag_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); + proto_item_set_text(VendorDiag_header_item, "%s", "VendorDiag"); + VendorDiag_header_tree = proto_item_add_subtree(VendorDiag_header_item, ett_vendordiag); + + proto_tree_add_item(VendorDiag_header_tree, hf_infiniband_VendorDiag_NextIndex, tvb, local_offset, 2, FALSE); local_offset +=2; + proto_tree_add_item(VendorDiag_header_tree, hf_infiniband_VendorDiag_DiagData, tvb, local_offset, 62, FALSE); local_offset +=62; +} + +/* Parse LedInfo Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_LedInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *LedInfo_header_tree = NULL; + proto_item *LedInfo_header_item = NULL; + + if(!parentTree) + return; + + LedInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); + proto_item_set_text(LedInfo_header_item, "%s", "LedInfo"); + LedInfo_header_tree = proto_item_add_subtree(LedInfo_header_item, ett_ledinfo); + + proto_tree_add_item(LedInfo_header_tree, hf_infiniband_LedInfo_LedMask, tvb, local_offset, 1, FALSE); +} + +/* Parse LinkSpeedWidthPairsTable Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_LinkSpeedWidthPairsTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *LinkSpeedWidthPairsTable_header_tree = NULL; + proto_item *LinkSpeedWidthPairsTable_header_item = NULL; + + if(!parentTree) + return; + + LinkSpeedWidthPairsTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE); + proto_item_set_text(LinkSpeedWidthPairsTable_header_item, "%s", "LinkSpeedWidthPairsTable"); + LinkSpeedWidthPairsTable_header_tree = proto_item_add_subtree(LinkSpeedWidthPairsTable_header_item, ett_linkspeedwidthpairs); + + proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_NumTables, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_PortMask, tvb, local_offset, 32, FALSE); local_offset +=32; + proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive, tvb, local_offset, 1, FALSE); local_offset +=1; + proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen, tvb, local_offset, 1, FALSE); local_offset +=1; +} + +/* Parse RID Field from Subnet Administraiton Packets. +* IN: SA_header_tree - the dissection tree of the subnet admin attribute. +* tvb - the packet buffer +* MadHeader - the Common MAD header from this packet. +* IN/OUT: offset - the current and updated offset in the packet buffer */ +static void parse_RID(proto_tree* SA_header_tree, tvbuff_t* tvb, gint *offset, MAD_Data* MadHeader) +{ + gint local_offset = *offset; + if(!SA_header_tree) + { + return; + } + switch(MadHeader->attributeID) + { + case 0x0011: + /* NodeRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset+=2; /* Reserved bits */ + break; + case 0x0012: + /* PortInfoRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_EndportLID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_PortNum, tvb, local_offset, 1, FALSE); local_offset+=1; + local_offset+=1; /* Reserved bits */ + break; + case 0x0013: + /* SLtoVLMappingTableRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_InputPortNum, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_OutputPortNum, tvb, local_offset, 1, FALSE); local_offset+=1; + local_offset+=4; /* Reserved bits */ + break; + case 0x0014: + /* SwitchInfoRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset+=2; /* Reserved bits */ + break; + case 0x0015: + /* LinearForwardingTableRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset+=4; /* Reserved bits */ + break; + case 0x0016: + /* RandomForwardingTableRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset+=4; /* Reserved bits */ + break; + case 0x0017: + /* MulticastForwardingTableRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_Position, tvb, local_offset, 1, FALSE); + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_NineBit, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset+=4; /* Reserved bits */ + break; + case 0x0036: + /*VLArbitrationTableRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_OutputPortNum, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_EightBit, tvb, local_offset, 1, FALSE); local_offset+=1; + local_offset+=4; /* Reserved bits */ + break; + case 0x0018: + /* SMInfoRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset+=2; /* Reserved bits */ + break; + case 0x0033: + /* P_KeyTableRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_PortNum, tvb, local_offset, 1, FALSE); local_offset+=1; + local_offset+=3; /* Reserved bits */ + break; + case 0x00F3: + /* InformInfoRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_InformInfoRecord_SubscriberGID, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_tree_add_item(SA_header_tree, hf_infiniband_InformInfoRecord_Enum, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset+=6; /* Reserved bits */ + break; + case 0x0020: + /* LinkRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_LinkRecord_FromLID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(SA_header_tree, hf_infiniband_LinkRecord_FromPort, tvb, local_offset, 1, FALSE); local_offset+=1; + break; + case 0x0031: + /* ServiceRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceID, tvb, local_offset, 8, FALSE); local_offset+=8; + proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceGID, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceP_Key, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset+=2; + break; + case 0x0038: + /* MCMemberRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_MCMemberRecord_MGID, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_tree_add_item(SA_header_tree, hf_infiniband_MCMemberRecord_PortGID, tvb, local_offset, 16, FALSE); local_offset+=16; + break; + case 0x0030: + /* GuidInfoRecord */ + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_EightBit, tvb, local_offset, 1, FALSE); local_offset+=2; + local_offset+=4; + break; + default: + break; + } *offset = local_offset; } +/* Parse InformInfo Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_InformInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *InformInfo_header_tree = NULL; + proto_item *InformInfo_header_item = NULL; + if(!parentTree) + { + return; + } + InformInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 36, FALSE); + proto_item_set_text(InformInfo_header_item, "%s", "InformInfo"); + InformInfo_header_tree = proto_item_add_subtree(InformInfo_header_item, ett_informinfo); + + proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_GID, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_LIDRangeBegin, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_LIDRangeEnd, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset+=2; /* Reserved Bits */ + proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_IsGeneric, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_Subscribe, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_Type, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_TrapNumberDeviceID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_QPN, tvb, local_offset, 3, FALSE); local_offset+=3; + proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_RespTimeValue, tvb, local_offset, 1, FALSE); local_offset+=1; + local_offset+=1; + proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_ProducerTypeVendorID, tvb, local_offset, 3, FALSE); local_offset+=3; + +} +/* Parse LinkRecord Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_LinkRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *LinkRecord_header_tree = NULL; + proto_item *LinkRecord_header_item = NULL; + + if(!parentTree) + { + return; + } + + LinkRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 3, FALSE); + proto_item_set_text(LinkRecord_header_item, "%s", "LinkRecord"); + LinkRecord_header_tree = proto_item_add_subtree(LinkRecord_header_item, ett_linkrecord); + + proto_tree_add_item(LinkRecord_header_tree, hf_infiniband_LinkRecord_ToPort, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(LinkRecord_header_tree, hf_infiniband_LinkRecord_ToLID, tvb, local_offset, 2, FALSE); local_offset +=2; + +} +/* Parse ServiceRecord Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_ServiceRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *ServiceRecord_header_tree = NULL; + proto_item *ServiceRecord_header_item = NULL; + proto_item *tempData = NULL; + + if(!parentTree) + { + return; + } + + ServiceRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 176, FALSE); + proto_item_set_text(ServiceRecord_header_item, "%s", "ServiceRecord"); + ServiceRecord_header_tree = proto_item_add_subtree(ServiceRecord_header_item, ett_servicerecord); + + proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceLease, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceKey, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceName, tvb, local_offset, 64, FALSE); local_offset+=64; + + tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_item_append_text(tempData, "%s", "(ServiceData 8.1, 8.16)"); + tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_item_append_text(tempData, "%s", "(ServiceData 16.1, 16.8)"); + tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_item_append_text(tempData, "%s", "(ServiceData 32.1, 32.4)"); + tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_item_append_text(tempData, "%s", "(ServiceData 64.1, 64.2)"); + +} +/* Parse PathRecord Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_PathRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *PathRecord_header_tree = NULL; + proto_item *PathRecord_header_item = NULL; + + if(!parentTree) + { + return; + } + + PathRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 64, FALSE); + proto_item_set_text(PathRecord_header_item, "%s", "PathRecord"); + PathRecord_header_tree = proto_item_add_subtree(PathRecord_header_item, ett_pathrecord); + local_offset += 8; /* Reserved Bits */ + + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_DGID, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SGID, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_DLID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SLID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_RawTraffic, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_FlowLabel, tvb, local_offset, 3, FALSE); local_offset+=3; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_HopLimit, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_TClass, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Reversible, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_NumbPath, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_P_Key, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SL, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_MTUSelector, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_MTU, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_RateSelector, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Rate, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_PacketLifeTimeSelector, tvb, local_offset, 1, FALSE); + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_PacketLifeTime, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Preference, tvb, local_offset, 1, FALSE); local_offset+=1; +} +/* Parse MCMemberRecord Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_MCMemberRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *MCMemberRecord_header_tree = NULL; + proto_item *MCMemberRecord_header_item = NULL; + + if(!parentTree) + { + return; + } + + MCMemberRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 64, FALSE); + proto_item_set_text(MCMemberRecord_header_item, "%s", "MCMemberRecord"); + MCMemberRecord_header_tree = proto_item_add_subtree(MCMemberRecord_header_item, ett_mcmemberrecord); + + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Q_Key, tvb, local_offset, 4, FALSE); local_offset+=4; + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MLID, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MTUSelector, tvb, local_offset, 1, FALSE); + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MTU, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_TClass, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_P_Key, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_RateSelector, tvb, local_offset, 1, FALSE); + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Rate, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_PacketLifeTimeSelector, tvb, local_offset, 1, FALSE); + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_PacketLifeTime, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_SL, tvb, local_offset, 1, FALSE); + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_FlowLabel, tvb, local_offset, 3, FALSE); local_offset+=3; + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_HopLimit, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Scope, tvb, local_offset, 1, FALSE); + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_JoinState, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_ProxyJoin, tvb, local_offset, 1, FALSE); local_offset+=3; + +} +/* Parse TraceRecord Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_TraceRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *TraceRecord_header_tree = NULL; + proto_item *TraceRecord_header_item = NULL; + + if(!parentTree) + { + return; + } + + TraceRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 46, FALSE); + proto_item_set_text(TraceRecord_header_item, "%s", "TraceRecord"); + TraceRecord_header_tree = proto_item_add_subtree(TraceRecord_header_item, ett_tracerecord); + + proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_GIDPrefix, tvb, local_offset, 8, FALSE); local_offset+=8; + proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_IDGeneration, tvb, local_offset, 2, FALSE); local_offset+=2; + local_offset+=1; /* Reserved Bits */ + proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_NodeType, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_NodeID, tvb, local_offset, 8, FALSE); local_offset+=8; + proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ChassisID, tvb, local_offset, 8, FALSE); local_offset+=8; + proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_EntryPortID, tvb, local_offset, 8, FALSE); local_offset+=8; + proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ExitPortID, tvb, local_offset, 8, FALSE); local_offset+=8; + proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_EntryPort, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ExitPort, tvb, local_offset, 1, FALSE); local_offset+=1; +} +/* Parse MultiPathRecord Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_MultiPathRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *MultiPathRecord_header_tree = NULL; + proto_item *MultiPathRecord_header_item = NULL; + proto_item *SDGID = NULL; + guint8 SDGIDCount = 0; + guint8 DGIDCount = 0; + guint32 i = 0; + + if(!parentTree) + { + return; + } + + MultiPathRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 200, FALSE); + proto_item_set_text(MultiPathRecord_header_item, "%s", "MultiPathRecord"); + MultiPathRecord_header_tree = proto_item_add_subtree(MultiPathRecord_header_item, ett_multipathrecord); + + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_RawTraffic, tvb, local_offset, 1, FALSE); + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_FlowLabel, tvb, local_offset, 3, FALSE); local_offset+=3; + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_HopLimit, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_TClass, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_Reversible, tvb, local_offset, 1, FALSE); + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_NumbPath, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_P_Key, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SL, tvb, local_offset, 2, FALSE); local_offset+=2; + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_MTUSelector, tvb, local_offset, 1, FALSE); + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_MTU, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_RateSelector, tvb, local_offset, 1, FALSE); + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_Rate, tvb, local_offset, 1, FALSE); local_offset+=1; + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_PacketLifeTimeSelector, tvb, local_offset, 1, FALSE); + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_PacketLifeTime, tvb, local_offset, 1, FALSE); local_offset+=1; + local_offset+=1; /* Reserved Bits */ + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_IndependenceSelector, tvb, local_offset, 1, FALSE); + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_GIDScope, tvb, local_offset, 1, FALSE); local_offset+=1; + + SDGIDCount = tvb_get_guint8(tvb, local_offset); + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SGIDCount, tvb, local_offset, 1, FALSE); local_offset+=1; + DGIDCount = tvb_get_guint8(tvb, local_offset); + proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_DGIDCount, tvb, local_offset, 1, FALSE); local_offset+=1; + local_offset+=7; /*Reserved Bits */ + + for(i = 0; i < SDGIDCount; i++) + { + SDGID = proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SDGID, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_item_set_text(SDGID, "(%s%u)","SGID", i); + } + for(i = 0; i < DGIDCount; i++) + { + SDGID = proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SDGID, tvb, local_offset, 16, FALSE); local_offset+=16; + proto_item_set_text(SDGID, "(%s%u)","DGID", i); + } +} +/* Parse ServiceAssociationRecord Attribute +* IN: parentTree - The tree to add the dissection to +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* MadHeader - The common MAD header of the current SMP/SMA */ +static void parse_ServiceAssociationRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset) +{ + gint local_offset = *offset; + proto_tree *ServiceAssociationRecord_header_tree = NULL; + proto_item *ServiceAssociationRecord_header_item = NULL; + + if(!parentTree) + { + return; + } + + ServiceAssociationRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 80, FALSE); + proto_item_set_text(ServiceAssociationRecord_header_item, "%s", "ServiceAssociationRecord"); + ServiceAssociationRecord_header_tree = proto_item_add_subtree(ServiceAssociationRecord_header_item, ett_serviceassocrecord); + + proto_tree_add_item(ServiceAssociationRecord_header_tree, hf_infiniband_ServiceAssociationRecord_ServiceKey, tvb, local_offset, 16, FALSE); local_offset +=16; + proto_tree_add_item(ServiceAssociationRecord_header_tree, hf_infiniband_ServiceAssociationRecord_ServiceName, tvb, local_offset, 64, FALSE); local_offset +=64; +} + +/* dissect_general_info +* Used to extract very few values from the packet in the case that full dissection is disabled by the user. +* IN: +* tvb - The tvbbuff of packet data +* offset - The offset in TVB where the attribute begins +* pinfo - The packet info structure with column information */ +static void dissect_general_info(tvbuff_t *tvb, gint offset, packet_info *pinfo) +{ + guint8 lnh_val = 0; /* The Link Next Header Value. Tells us which headers are coming */ + gboolean bthFollows = 0; /* Tracks if we are parsing a BTH. This is a significant decision point */ + guint8 virtualLane = 0; /* The Virtual Lane of the current Packet */ + guint8 opCode = 0; /* OpCode from BTH header. */ + gint32 nextHeaderSequence = -1; /* defined by this dissector. #define which indicates the upcoming header sequence from OpCode */ + guint8 nxtHdr = 0; /* that must be available for that header. */ + struct e_in6_addr SRCgid; /* Struct to display ipv6 Address */ + struct e_in6_addr DSTgid; /* Struct to display ipv6 Address */ + guint8 management_class = 0; + MAD_Data MadData; + + + virtualLane = tvb_get_guint8(tvb, offset); + virtualLane = virtualLane & 0xF0; + offset+=1; + + /* Save Link Next Header... This tells us what the next header is. */ + lnh_val = tvb_get_guint8(tvb, offset); + lnh_val = lnh_val & 0x03; + offset+=1; + + /* Set destination in packet view. */ + if (check_col(pinfo->cinfo, COL_DEF_DST)) + { + col_set_str(pinfo->cinfo, COL_DEF_DST, "DLID: "); + col_set_fence(pinfo->cinfo, COL_DEF_DST); + col_set_str(pinfo->cinfo, COL_DEF_DST, tvb_bytes_to_str(tvb, offset, 2)); + } + offset+=4; + + /* Set Source in packet view. */ + if (check_col(pinfo->cinfo, COL_DEF_SRC)) + { + col_set_str(pinfo->cinfo, COL_DEF_SRC, "SLID: "); + col_set_fence(pinfo->cinfo, COL_DEF_SRC); + col_set_str(pinfo->cinfo, COL_DEF_SRC, tvb_bytes_to_str(tvb, offset, 2)); + } + offset+=2; + + switch(lnh_val) + { + case IBA_GLOBAL: + offset +=6; + nxtHdr = tvb_get_guint8(tvb, offset); + offset += 2; + + tvb_get_ipv6(tvb, offset, &SRCgid); + if (check_col(pinfo->cinfo, COL_DEF_SRC)) + { + col_set_str(pinfo->cinfo, COL_DEF_SRC, "SGID: "); + col_set_fence(pinfo->cinfo, COL_DEF_SRC); + col_set_str(pinfo->cinfo, COL_DEF_SRC, ip6_to_str(&SRCgid)); + } + offset += 16; + + tvb_get_ipv6(tvb, offset, &DSTgid); + if (check_col(pinfo->cinfo, COL_DEF_DST)) + { + col_set_str(pinfo->cinfo, COL_DEF_DST, "DGID: "); + col_set_fence(pinfo->cinfo, COL_DEF_DST); + col_set_str(pinfo->cinfo, COL_DEF_DST, ip6_to_str(&DSTgid)); + } + offset += 16; + + if(nxtHdr != 0x1B) + { + /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */ + break; + } + /* else + * { + * Fall through switch and start parsing Local Headers and BTH + * } + */ + case IBA_LOCAL: + bthFollows = TRUE; + + /* Get the OpCode - this tells us what headers are following */ + opCode = tvb_get_guint8(tvb, offset); + if (check_col(pinfo->cinfo, COL_INFO)) + { + col_append_str(pinfo->cinfo, COL_INFO, val_to_str((guint32)opCode, OpCodeMap, "Unknown OpCode")); + } + offset +=12; + break; + case IP_NON_IBA: + /* Raw IPv6 Packet */ + if (check_col(pinfo->cinfo, COL_DEF_DST)) + { + col_set_str(pinfo->cinfo, COL_DEF_DST, "IPv6 over IB Packet"); + col_set_fence(pinfo->cinfo, COL_DEF_DST); + } + break; + case RAW: + break; + default: + break; + } + + if(bthFollows) + { + /* Find our next header sequence based on the Opcode + * Since we're not doing dissection here, we just need the proper offsets to get our labels in packet view */ + + nextHeaderSequence = find_next_header_sequence((guint32) opCode); + switch(nextHeaderSequence) + { + case RDETH_DETH_PAYLD: + offset += 4; /* RDETH */ + offset += 8; /* DETH */ + break; + case RDETH_DETH_RETH_PAYLD: + offset += 4; /* RDETH */ + offset += 8; /* DETH */ + offset += 16; /* RETH */ + break; + case RDETH_DETH_IMMDT_PAYLD: + offset += 4; /* RDETH */ + offset += 8; /* DETH */ + offset += 4; /* IMMDT */ + break; + case RDETH_DETH_RETH_IMMDT_PAYLD: + offset += 4; /* RDETH */ + offset += 8; /* DETH */ + offset += 16; /* RETH */ + offset += 4; /* IMMDT */ + break; + case RDETH_DETH_RETH: + offset += 4; /* RDETH */ + offset += 8; /* DETH */ + offset += 16; /* RETH */ + break; + case RDETH_AETH_PAYLD: + offset += 4; /* RDETH */ + offset += 4; /* AETH */ + break; + case RDETH_PAYLD: + offset += 4; /* RDETH */ + break; + case RDETH_AETH: + offset += 4; /* RDETH */ + offset += 4; /* AETH */ + break; + case RDETH_AETH_ATOMICACKETH: + offset += 4; /* RDETH */ + offset += 4; /* AETH */ + offset += 8; /* AtomicAckETH */ + break; + case RDETH_DETH_ATOMICETH: + offset += 4; /* RDETH */ + offset += 8; /* DETH */ + offset += 28; /* AtomicETH */ + break; + case RDETH_DETH: + offset += 4; /* RDETH */ + offset += 8; /* DETH */ + break; + case DETH_PAYLD: + offset += 8; /* DETH */ + break; + case PAYLD: + break; + case IMMDT_PAYLD: + offset += 4; /* IMMDT */ + break; + case RETH_PAYLD: + offset += 16; /* RETH */ + break; + case RETH: + offset += 16; /* RETH */ + break; + case AETH_PAYLD: + offset += 4; /* AETH */ + break; + case AETH: + offset += 4; /* AETH */ + break; + case AETH_ATOMICACKETH: + offset += 4; /* AETH */ + offset += 8; /* AtomicAckETH */ + break; + case ATOMICETH: + offset += 28; /* AtomicETH */ + break; + case IETH_PAYLD: + offset += 4; /* IETH */ + break; + case DETH_IMMDT_PAYLD: + offset += 8; /* DETH */ + offset += 4; /* IMMDT */ + break; + default: + break; + } + } + if(virtualLane == 0xF0) + { + management_class = tvb_get_guint8(tvb, offset + 1); + if(((management_class >= (guint8)VENDOR_1_START) && (management_class <= (guint8)VENDOR_1_END)) + || ((management_class >= (guint8)VENDOR_2_START) && (management_class <= (guint8)VENDOR_2_END))) + { + return; + } + else if((management_class >= (guint8)APPLICATION_START) && (management_class <= (guint8)APPLICATION_END)) + { + return; + } + else if(((management_class == (guint8)0x00) || (management_class == (guint8)0x02)) + || ((management_class >= (guint8)0x50) && (management_class <= (guint8)0x80)) + || ((management_class >= (guint8)0x82))) + { + return; + } + else /* we have a normal management_class */ + { + parse_MAD_Common(NULL, tvb, &offset, &MadData); + label_SUBM_Method(NULL, &MadData); + label_SUBM_Attribute(NULL, &MadData); + } + } + return; +} diff --git a/plugins/infiniband/packet-infiniband.h b/plugins/infiniband/packet-infiniband.h index f1954f3dcb..1b1726409f 100644 --- a/plugins/infiniband/packet-infiniband.h +++ b/plugins/infiniband/packet-infiniband.h @@ -24,52 +24,369 @@ #define PROTO_TAG_INFINIBAND "Infiniband" +#include <epan/etypes.h> + /* Wireshark ID */ static int proto_infiniband = -1; -/*static int hf_infiniband_pdu_type = -1; unnecessary for now */ + +/* Variables to hold expansion values between packets */ static gint ett_infiniband = -1; +static gint ett_all_headers = -1; +static gint ett_lrh = -1; +static gint ett_grh = -1; +static gint ett_bth = -1; +static gint ett_rwh = -1; +static gint ett_rawdata = -1; +static gint ett_rdeth = -1; +static gint ett_deth = -1; +static gint ett_reth = -1; +static gint ett_atomiceth = -1; +static gint ett_aeth = -1; +static gint ett_atomicacketh = -1; +static gint ett_immdt = -1; +static gint ett_ieth = -1; +static gint ett_payload = -1; +static gint ett_vendor = -1; +static gint ett_subn_lid_routed = -1; +static gint ett_subn_directed_route = -1; +static gint ett_subnadmin = -1; +static gint ett_mad = -1; +static gint ett_rmpp = -1; +static gint ett_subm_attribute = -1; +static gint ett_suba_attribute = -1; +static gint ett_datadetails = -1; +static gint ett_noticestraps = -1; +static gint ett_nodedesc = -1; +static gint ett_nodeinfo = -1; +static gint ett_switchinfo = -1; +static gint ett_guidinfo = -1; +static gint ett_portinfo = -1; +static gint ett_portinfo_capmask = -1; +static gint ett_pkeytable = -1; +static gint ett_sltovlmapping = -1; +static gint ett_vlarbitrationtable = -1; +static gint ett_linearforwardingtable = -1; +static gint ett_randomforwardingtable = -1; +static gint ett_multicastforwardingtable = -1; +static gint ett_sminfo = -1; +static gint ett_vendordiag = -1; +static gint ett_ledinfo = -1; +static gint ett_linkspeedwidthpairs = -1; +static gint ett_informinfo = -1; +static gint ett_linkrecord = -1; +static gint ett_servicerecord = -1; +static gint ett_pathrecord = -1; +static gint ett_mcmemberrecord = -1; +static gint ett_tracerecord = -1; +static gint ett_multipathrecord = -1; +static gint ett_serviceassocrecord = -1; +/* Static ref to column_info for dissection */ +static column_info *g_cinfo = NULL; +static packet_info *g_pinfo = NULL; +/* Global ref to highest level tree should we find other protocols encapsulated in IB */ +static proto_tree *top_tree = NULL; + +/* MAD_Data +* Structure to hold information from the common MAD header. +* This is necessary because the MAD header contains information which significantly changes the dissection algorithm. */ +typedef struct { + guint8 managementClass; + guint8 classVersion; + guint8 method; + guint8 status; + guint16 classSpecific; + guint64 transactionID; + guint16 attributeID; + guint32 attributeModifier; + char data[232]; +} MAD_Data; /* Dissector Declarations */ static dissector_handle_t infiniband_handle; +static dissector_handle_t ipv6_handle; +static dissector_handle_t ip_handle; +static dissector_handle_t arp_handle; +static dissector_handle_t rarp_handle; +static dissector_handle_t data_handle; +static dissector_table_t ethertype_dissector_table; + void proto_register_infiniband(void); void proto_reg_handoff_infiniband(void); static void dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree); static gint32 find_next_header_sequence(guint32 OpCode); static gboolean contains(guint32 value, guint32* arr, int length); +static void dissect_general_info(tvbuff_t *tvb, gint offset, packet_info *pinfo); /* Parsing Methods for specific IB headers. */ -static void parse_VENDOR(proto_tree * parentTree, tvbuff_t *tvb, gint *offset); -static void parse_PAYLOAD(proto_tree * parentTree, tvbuff_t *tvb, gint *offset, gint length); -static void parse_IETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset); -static void parse_IMMDT(proto_tree * parentTree, tvbuff_t *tvb, gint *offset); -static void parse_ATOMICACKETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset); -static void parse_AETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset); -static void parse_ATOMICETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset); -static void parse_RETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset); -static void parse_DETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset); -static void parse_RDETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset); - -/* These are not currently used, but in the future */ -/* can be expanded and used to provide better visualization in Wireshark. */ -static const value_string packettypenames[] = -{ - { 4, "Local" }, - { 3, "Global" }, - { 2, "Raw (Raw Header)" }, - { 1, "Raw (IPv6 Header)"}, +static void parse_VENDOR(proto_tree *, tvbuff_t *, gint *); +static void parse_PAYLOAD(proto_tree *, tvbuff_t *, gint *, gint length, guint8 virtualLane); +static void parse_IETH(proto_tree *, tvbuff_t *, gint *); +static void parse_IMMDT(proto_tree *, tvbuff_t *, gint *offset); +static void parse_ATOMICACKETH(proto_tree *, tvbuff_t *, gint *offset); +static void parse_AETH(proto_tree *, tvbuff_t *, gint *offset); +static void parse_ATOMICETH(proto_tree *, tvbuff_t *, gint *offset); +static void parse_RETH(proto_tree *, tvbuff_t *, gint *offset); +static void parse_DETH(proto_tree *, tvbuff_t *, gint *offset); +static void parse_RDETH(proto_tree *, tvbuff_t *, gint *offset); +static void parse_IPvSix(proto_tree *, tvbuff_t *, gint *offset, packet_info *pinfo); +static void parse_RWH(proto_tree *, tvbuff_t *, gint *offset, packet_info *pinfo); + +static void parse_SUBN_LID_ROUTED(proto_tree *, tvbuff_t *, gint *offset); +static void parse_SUBN_DIRECTED_ROUTE(proto_tree *, tvbuff_t *, gint *offset); +static void parse_SUBNADMN(proto_tree *, tvbuff_t *, gint *offset); +static void parse_PERF(proto_tree *, tvbuff_t *, gint *offset); +static void parse_BM(proto_tree *, tvbuff_t *, gint *offset); +static void parse_DEV_MGT(proto_tree *, tvbuff_t *, gint *offset); +static void parse_COM_MGT(proto_tree *, tvbuff_t *, gint *offset); +static void parse_SNMP(proto_tree *, tvbuff_t *, gint *offset); +static void parse_VENDOR_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset); +static void parse_APPLICATION_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset); +static void parse_RESERVED_MANAGEMENT(proto_tree *, tvbuff_t *, gint *offset); + +static gboolean parse_MAD_Common(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*); +static gboolean parse_RMPP(proto_tree* , tvbuff_t* , gint *offset); +static void label_SUBM_Method(proto_item*, MAD_Data*); +static void label_SUBM_Attribute(proto_item*, MAD_Data*); +static void label_SUBA_Method(proto_item*, MAD_Data*); +static void label_SUBA_Attribute(proto_item*, MAD_Data*); + +/* Class Attribute Parsing Routines */ +static gboolean parse_SUBM_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*); +static gboolean parse_SUBA_Attribute(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*); + +/* These methods parse individual attributes +* Naming convention FunctionHandle = "parse_" + [Attribute Name]; +* Where [Attribute Name] is the attribute identifier from chapter 14 of the IB Specification +* Subnet Management */ +static void parse_NoticesAndTraps(proto_tree*, tvbuff_t*, gint *offset); +static void parse_NodeDescription(proto_tree*, tvbuff_t*, gint *offset); +static void parse_NodeInfo(proto_tree*, tvbuff_t*, gint *offset); +static void parse_SwitchInfo(proto_tree*, tvbuff_t*, gint *offset); +static void parse_GUIDInfo(proto_tree*, tvbuff_t*, gint *offset); +static void parse_PortInfo(proto_tree*, tvbuff_t*, gint *offset); +static void parse_P_KeyTable(proto_tree*, tvbuff_t*, gint *offset); +static void parse_SLtoVLMappingTable(proto_tree*, tvbuff_t*, gint *offset); +static void parse_VLArbitrationTable(proto_tree*, tvbuff_t*, gint *offset); +static void parse_LinearForwardingTable(proto_tree*, tvbuff_t*, gint *offset); +static void parse_RandomForwardingTable(proto_tree*, tvbuff_t*, gint *offset); +static void parse_MulticastForwardingTable(proto_tree*, tvbuff_t*, gint *offset); +static void parse_SMInfo(proto_tree*, tvbuff_t*, gint *offset); +static void parse_VendorDiag(proto_tree*, tvbuff_t*, gint *offset); +static void parse_LedInfo(proto_tree*, tvbuff_t*, gint *offset); +static void parse_LinkSpeedWidthPairsTable(proto_tree*, tvbuff_t*, gint *offset); + +/* Subnet Administration */ +static void parse_InformInfo(proto_tree*, tvbuff_t*, gint *offset); +static void parse_LinkRecord(proto_tree*, tvbuff_t*, gint *offset); +static void parse_ServiceRecord(proto_tree*, tvbuff_t*, gint *offset); +static void parse_PathRecord(proto_tree*, tvbuff_t*, gint *offset); +static void parse_MCMemberRecord(proto_tree*, tvbuff_t*, gint *offset); +static void parse_TraceRecord(proto_tree*, tvbuff_t*, gint *offset); +static void parse_MultiPathRecord(proto_tree*, tvbuff_t*, gint *offset); +static void parse_ServiceAssociationRecord(proto_tree*, tvbuff_t*, gint *offset); + +/* Subnet Administration */ +static void parse_RID(proto_tree*, tvbuff_t*, gint *offset, MAD_Data*); + +/* SM Attributes */ +static const value_string SUBM_Attributes[] = { + { 0x0001, "Attribute (ClassPortInfo)"}, + { 0x0002, "Attribute (Notice)"}, + { 0x0003, "Attribute (InformInfo)"}, + { 0x0010, "Attribute (NodeDescription)"}, + { 0x0011, "Attribute (NodeInfo)"}, + { 0x0012, "Attribute (SwitchInfo)"}, + { 0x0014, "Attribute (GUIDInfo)"}, + { 0x0015, "Attribute (PortInfo)"}, + { 0x0016, "Attribute (P_KeyTable)"}, + { 0x0017, "Attribute (SLtoVLMapptingTable)"}, + { 0x0018, "Attribute (VLArbitrationTable)"}, + { 0x0019, "Attribute (LinearForwardingTable)"}, + { 0x001A, "Attribute (RandomForwardingTable)"}, + { 0x001B, "Attribute (MulticastForwardingTable)"}, + { 0x001C, "Attribute (LinkSpeedWidthPairsTable)"}, + { 0x0020, "Attribute (SMInfo)"}, + { 0x0030, "Attribute (VendorDiag)"}, + { 0x0031, "Attribute (LedInfo)"} +}; +/* SA Attributes */ +static const value_string SUBA_Attributes[] = { + { 0x0001, "Attribute (ClassPortInfo)"}, + { 0x0002, "Attribute (Notice)"}, + { 0x0003, "Attribute (InformInfo)"}, + { 0x0011, "Attribute (NodeRecord)"}, + { 0x0012, "Attribute (PortInfoRecord)"}, + { 0x0013, "Attribute (SLtoVLMappingTableRecord)"}, + { 0x0014, "Attribute (SwitchInfoRecord)"}, + { 0x0015, "Attribute (LinearForwardingTableRecord)"}, + { 0x0016, "Attribute (RandomForwardingTableRecord)"}, + { 0x0017, "Attribute (MulticastForwardingTableRecord)"}, + { 0x0018, "Attribute (SMInfoRecord)"}, + { 0x0019, "Attribute (LinkSpeedWidthPairsTableRecord)"}, + { 0x00F3, "Attribute (InformInfoRecord)"}, + { 0x0020, "Attribute (LinkRecord)"}, + { 0x0030, "Attribute (GuidInfoRecord)"}, + { 0x0031, "Attribute (ServiceRecord)"}, + { 0x0033, "Attribute (P_KeyTableRecord)"}, + { 0x0035, "Attribute (PathRecord)"}, + { 0x0036, "Attribute (VLArbitrationTableRecord)"}, + { 0x0038, "Attribute (MCMembersRecord)"}, + { 0x0039, "Attribute (TraceRecord)"}, + { 0x003A, "Attribute (MultiPathRecord)"}, + { 0x003B, "Attribute (ServiceAssociationRecord)"} +}; + + +/* RMPP Types */ +#define RMPP_ILLEGAL 0 +#define RMPP_DATA 1 +#define RMPP_ACK 2 +#define RMPP_STOP 3 +#define RMPP_ABORT 4 + +static const value_string RMPP_Packet_Types[] = { + { RMPP_ILLEGAL, " Illegal RMPP Type (0)! " }, + { RMPP_DATA, "RMPP (DATA)" }, + { RMPP_ACK, "RMPP (ACK)" }, + { RMPP_STOP, "RMPP (STOP)" }, + { RMPP_ABORT, "RMPP (ABORT)" } +}; + +static const value_string RMPP_Flags[] = { + { 3, " (Transmission Sequence - First Packet)"}, + { 5, " (Transmission Sequence - Last Packet)"}, + { 1, " (Transmission Sequence) " }, { 0, NULL} }; -/* Just a map so we can display a value for FT_BOOLEAN types */ +static const value_string RMPP_Status[]= { + { 0, " (Normal)"}, + { 1, " (Resources Exhausted)"}, + { 118, " (Total Time Too Long)"}, + { 119, " (Inconsistent Last and PayloadLength)"}, + { 120, " (Inconsistent First and Segment Number)"}, + { 121, " (Bad RMPPType)"}, + { 122, " (NewWindowLast Too Small)"}, + { 123, " (SegmentNumber Too Big)"}, + { 124, " (Illegal Status)"}, + { 125, " (Unsupported Version)"}, + { 126, " (Too Many Retries)"}, + { 127, " (Unspecified - Unknown Error Code on ABORT)"} +}; -static const value_string IB_Boolean[] = { - { 0, " 0 " }, - { 1, " 1 " }, - { 2, NULL } +static const value_string DiagCode[]= { + {0x0000, "Function Ready"}, + {0x0001, "Performing Self Test"}, + {0x0002, "Initializing"}, + {0x0003, "Soft Error - Function has non-fatal error"}, + {0x0004, "Hard Error - Function has fatal error"} }; - +static const value_string LinkWidthEnabled[]= { + {0x0000, "No State Change"}, + {0x0001, "1x"}, + {0x0002, "4x"}, + {0x0003, "1x or 4x"}, + {0x0004, "8x"}, + {0x0005, "1x or 8x"}, + {0x0006, "4x or 8x"}, + {0x0007, "1x or 4x or 8x"}, + {0x0008, "12x"}, + {0x0009, "1x or 12x"}, + {0x000A, "4x or 12x"}, + {0x000B, "1x or 4x or 12x"}, + {0x000C, "8x or 12x"}, + {0x000D, "1x or 8x or 12x"}, + {0x000E, "4x or 8x or 12x"}, + {0x000E, "1x or 4x or 8x or 12x"}, + {0x00FF, "Set to LinkWidthSupported Value - Response contains actual LinkWidthSupported"} +}; + +static const value_string LinkWidthSupported[]= { + {0x0001, "1x"}, + {0x0003, "1x or 4x"}, + {0x0007, "1x or 4x or 8x"}, + {0x000B, "1x or 4x or 12x"}, + {0x000F, "1x or 4x or 8x or 12x"} +}; +static const value_string LinkWidthActive[]= { + {0x0001, "1x"}, + {0x0002, "4x"}, + {0x0004, "8x"}, + {0x0008, "12x"} +}; +static const value_string LinkSpeedSupported[]= { + {0x0001, "2.5 Gbps"}, + {0x0003, "2.5 or 5.0 Gbps"}, + {0x0005, "2.5 or 10.0 Gbps"}, + {0x0007, "2.5 or 5.0 or 10.0 Gbps"}, +}; +static const value_string PortState[]= { + {0x0000, "No State Change"}, + {0x0001, "Down (includes failed links)"}, + {0x0002, "Initialized"}, + {0x0003, "Armed"}, + {0x0004, "Active"} +}; +static const value_string PortPhysicalState[]= { + {0x0000, "No State Change"}, + {0x0001, "Sleep"}, + {0x0002, "Polling"}, + {0x0003, "Disabled"}, + {0x0004, "PortConfigurationTraining"}, + {0x0005, "LinkUp"}, + {0x0006, "LinkErrorRecovery"}, + {0x0007, "Phy Test"} +}; +static const value_string LinkDownDefaultState[]= { + {0x0000, "No State Change"}, + {0x0001, "Sleep"}, + {0x0002, "Polling"} +}; +static const value_string LinkSpeedActive[]= { + {0x0001, "2.5 Gbps"}, + {0x0002, "5.0 Gbps"}, + {0x0004, "10.0 Gbps"} +}; +static const value_string LinkSpeedEnabled[]= { + {0x0000, "No State Change"}, + {0x0001, "2.5 Gbps"}, + {0x0003, "2.5 or 5.0 Gbps"}, + {0x0005, "2.5 or 10.0 Gbps"}, + {0x0007, "2.5 or 5.0 or 10.0 Gbps"}, + {0x000F, "Set to LinkSpeedSupported value - response contains actual LinkSpeedSupported"} +}; +static const value_string NeighborMTU[]= { + {0x0001, "256"}, + {0x0002, "512"}, + {0x0003, "1024"}, + {0x0004, "2048"}, + {0x0005, "4096"} +}; +static const value_string VLCap[]= { + {0x0001, "VL0"}, + {0x0002, "VL0, VL1"}, + {0x0003, "VL0 - VL3"}, + {0x0004, "VL0 - VL7"}, + {0x0005, "VL0 - VL14"} +}; +static const value_string MTUCap[]= { + {0x0001, "256"}, + {0x0002, "512"}, + {0x0003, "1024"}, + {0x0004, "2048"}, + {0x0005, "4096"} +}; +static const value_string OperationalVLs[]= { + {0x0000, "No State Change"}, + {0x0001, "VL0"}, + {0x0002, "VL0, VL1"}, + {0x0003, "VL0 - VL3"}, + {0x0004, "VL0 - VL7"}, + {0x0005, "VL0 - VL14"} +}; + /* Local Route Header (LRH) */ static int hf_infiniband_LRH = -1; static int hf_infiniband_virtual_lane = -1; @@ -104,6 +421,10 @@ static int hf_infiniband_destination_qp = -1; static int hf_infiniband_acknowledge_request = -1; static int hf_infiniband_reserved7 = -1; static int hf_infiniband_packet_sequence_number = -1; +/* Raw Header (RWH) */ +static int hf_infiniband_RWH = -1; +static int hf_infiniband_reserved16_RWH = -1; +static int hf_infiniband_etype = -1; /* Reliable Datagram Extended Transport Header (RDETH) */ static int hf_infiniband_RDETH = -1; static int hf_infiniband_reserved8_RDETH = -1; @@ -142,8 +463,479 @@ static int hf_infiniband_variant_crc = -1; /* Unknown or Vendor Specific */ static int hf_infiniband_raw_data = -1; static int hf_infiniband_vendor = -1; +/* MAD Base Header */ +static int hf_infiniband_MAD = -1; +static int hf_infiniband_base_version = -1; +static int hf_infiniband_mgmt_class = -1; +static int hf_infiniband_class_version = -1; +static int hf_infiniband_reserved1 = -1; +static int hf_infiniband_method = -1; +static int hf_infiniband_status = -1; +static int hf_infiniband_class_specific = -1; +static int hf_infiniband_transaction_id = -1; +static int hf_infiniband_attribute_id = -1; +static int hf_infiniband_reserved16 = -1; +static int hf_infiniband_attribute_modifier = -1; +static int hf_infiniband_data = -1; +/* RMPP Header */ +static int hf_infiniband_RMPP = -1; +static int hf_infiniband_rmpp_version = -1; +static int hf_infiniband_rmpp_type = -1; +static int hf_infiniband_r_resp_time = -1; +static int hf_infiniband_rmpp_flags = -1; +static int hf_infiniband_rmpp_status = -1; +static int hf_infiniband_rmpp_data1 = -1; +static int hf_infiniband_rmpp_data2 = -1; +/* RMPP Data */ +static int hf_infiniband_RMPP_DATA = -1; +static int hf_infiniband_segment_number = -1; +static int hf_infiniband_payload_length32 = -1; +static int hf_infiniband_transferred_data = -1; +/* RMPP ACK */ +static int hf_infiniband_new_window_last = -1; +static int hf_infiniband_reserved220 = -1; +/* RMPP ABORT and STOP */ +static int hf_infiniband_reserved32 = -1; +static int hf_infiniband_optional_extended_error_data = -1; +/* SMP Data LID Routed */ +static int hf_infiniband_SMP_LID = -1; +static int hf_infiniband_m_key = -1; +static int hf_infiniband_smp_data = -1; +static int hf_infiniband_reserved1024 = -1; +static int hf_infiniband_reserved256 = -1; +/* SMP Data Directed Route */ +static int hf_infiniband_SMP_DIRECTED = -1; +static int hf_infiniband_smp_status = -1; +static int hf_infiniband_hop_pointer = -1; +static int hf_infiniband_hop_count = -1; +static int hf_infiniband_dr_slid = -1; +static int hf_infiniband_dr_dlid = -1; +static int hf_infiniband_reserved28 = -1; +static int hf_infiniband_d = -1; +static int hf_infiniband_initial_path = -1; +static int hf_infiniband_return_path = -1; +/* SA MAD Header */ +static int hf_infiniband_SA = -1; +static int hf_infiniband_sm_key = -1; +static int hf_infiniband_attribute_offset = -1; +static int hf_infiniband_component_mask = -1; +static int hf_infiniband_subnet_admin_data = -1; + +/* Attributes +* Additional Structures for individuala attribute decoding. +* Since they are not headers the naming convention is slightly modified +* Convention: hf_infiniband_[attribute name]_[field] +* This was not entirely necessary but I felt the previous convention +* did not provide adequate readability for the granularity of attribute/attribute fields. */ + +/* NodeDescription */ +static int hf_infiniband_NodeDescription_NodeString = -1; +/* NodeInfo */ +static int hf_infiniband_NodeInfo_BaseVersion = -1; +static int hf_infiniband_NodeInfo_ClassVersion = -1; +static int hf_infiniband_NodeInfo_NodeType = -1; +static int hf_infiniband_NodeInfo_NumPorts = -1; +static int hf_infiniband_NodeInfo_SystemImageGUID = -1; +static int hf_infiniband_NodeInfo_NodeGUID = -1; +static int hf_infiniband_NodeInfo_PortGUID = -1; +static int hf_infiniband_NodeInfo_PartitionCap = -1; +static int hf_infiniband_NodeInfo_DeviceID = -1; +static int hf_infiniband_NodeInfo_Revision = -1; +static int hf_infiniband_NodeInfo_LocalPortNum = -1; +static int hf_infiniband_NodeInfo_VendorID = -1; +/* SwitchInfo */ +static int hf_infiniband_SwitchInfo_LinearFDBCap = -1; +static int hf_infiniband_SwitchInfo_RandomFDBCap = -1; +static int hf_infiniband_SwitchInfo_MulticastFDBCap = -1; +static int hf_infiniband_SwitchInfo_LinearFDBTop = -1; +static int hf_infiniband_SwitchInfo_DefaultPort = -1; +static int hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort = -1; +static int hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort = -1; +static int hf_infiniband_SwitchInfo_LifeTimeValue = -1; +static int hf_infiniband_SwitchInfo_PortStateChange = -1; +static int hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming = -1; +static int hf_infiniband_SwitchInfo_LIDsPerPort = -1; +static int hf_infiniband_SwitchInfo_PartitionEnforcementCap = -1; +static int hf_infiniband_SwitchInfo_InboundEnforcementCap = -1; +static int hf_infiniband_SwitchInfo_OutboundEnforcementCap = -1; +static int hf_infiniband_SwitchInfo_FilterRawInboundCap = -1; +static int hf_infiniband_SwitchInfo_FilterRawOutboundCap = -1; +static int hf_infiniband_SwitchInfo_EnhancedPortZero = -1; +/* GUIDInfo */ +static int hf_infiniband_GUIDInfo_GUIDBlock = -1; +static int hf_infiniband_GUIDInfo_GUID = -1; +/* PortInfo */ +static int hf_infiniband_PortInfo_GidPrefix = -1; +static int hf_infiniband_PortInfo_LID = -1; +static int hf_infiniband_PortInfo_MasterSMLID = -1; +static int hf_infiniband_PortInfo_CapabilityMask = -1; + +/* Capability Mask Flags */ +static int hf_infiniband_PortInfo_CapabilityMask_SM; +static int hf_infiniband_PortInfo_CapabilityMask_NoticeSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_TrapSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM = -1; +static int hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM = -1; +static int hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_SMdisabled = -1; +static int hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_ReinitSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported = -1; +static int hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported = -1; +/* End Capability Mask Flags */ + + +static int hf_infiniband_PortInfo_DiagCode = -1; +static int hf_infiniband_PortInfo_M_KeyLeasePeriod = -1; +static int hf_infiniband_PortInfo_LocalPortNum = -1; +static int hf_infiniband_PortInfo_LinkWidthEnabled = -1; +static int hf_infiniband_PortInfo_LinkWidthSupported = -1; +static int hf_infiniband_PortInfo_LinkWidthActive = -1; +static int hf_infiniband_PortInfo_LinkSpeedSupported = -1; +static int hf_infiniband_PortInfo_PortState = -1; +static int hf_infiniband_PortInfo_PortPhysicalState = -1; +static int hf_infiniband_PortInfo_LinkDownDefaultState = -1; +static int hf_infiniband_PortInfo_M_KeyProtectBits = -1; +static int hf_infiniband_PortInfo_LMC = -1; +static int hf_infiniband_PortInfo_LinkSpeedActive = -1; +static int hf_infiniband_PortInfo_LinkSpeedEnabled = -1; +static int hf_infiniband_PortInfo_NeighborMTU = -1; +static int hf_infiniband_PortInfo_MasterSMSL = -1; +static int hf_infiniband_PortInfo_VLCap = -1; +static int hf_infiniband_PortInfo_M_Key = -1; +static int hf_infiniband_PortInfo_InitType = -1; +static int hf_infiniband_PortInfo_VLHighLimit = -1; +static int hf_infiniband_PortInfo_VLArbitrationHighCap = -1; +static int hf_infiniband_PortInfo_VLArbitrationLowCap = -1; +static int hf_infiniband_PortInfo_InitTypeReply = -1; +static int hf_infiniband_PortInfo_MTUCap = -1; +static int hf_infiniband_PortInfo_VLStallCount = -1; +static int hf_infiniband_PortInfo_HOQLife = -1; +static int hf_infiniband_PortInfo_OperationalVLs = -1; +static int hf_infiniband_PortInfo_PartitionEnforcementInbound = -1; +static int hf_infiniband_PortInfo_PartitionEnforcementOutbound = -1; +static int hf_infiniband_PortInfo_FilterRawInbound = -1; +static int hf_infiniband_PortInfo_FilterRawOutbound = -1; +static int hf_infiniband_PortInfo_M_KeyViolations = -1; +static int hf_infiniband_PortInfo_P_KeyViolations = -1; +static int hf_infiniband_PortInfo_Q_KeyViolations = -1; +static int hf_infiniband_PortInfo_GUIDCap = -1; +static int hf_infiniband_PortInfo_ClientReregister = -1; +static int hf_infiniband_PortInfo_SubnetTimeOut = -1; +static int hf_infiniband_PortInfo_RespTimeValue = -1; +static int hf_infiniband_PortInfo_LocalPhyErrors = -1; +static int hf_infiniband_PortInfo_OverrunErrors = -1; +static int hf_infiniband_PortInfo_MaxCreditHint = -1; +static int hf_infiniband_PortInfo_LinkRoundTripLatency = -1; + +/* P_KeyTable */ +static int hf_infiniband_P_KeyTable_P_KeyTableBlock = -1; +static int hf_infiniband_P_KeyTable_MembershipType = -1; +static int hf_infiniband_P_KeyTable_P_KeyBase = -1; + +/* SLtoVLMappingTable */ +static int hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits = -1; +static int hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits = -1; + +/* VLArbitrationTable */ +static int hf_infiniband_VLArbitrationTable_VLWeightPairs = -1; +static int hf_infiniband_VLArbitrationTable_VL = -1; +static int hf_infiniband_VLArbitrationTable_Weight = -1; + +/* LinearForwardingTable */ +static int hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock = -1; +static int hf_infiniband_LinearForwardingTable_Port = -1; + +/* RandomForwardingTable */ +static int hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock = -1; +static int hf_infiniband_RandomForwardingTable_LID = -1; +static int hf_infiniband_RandomForwardingTable_Valid = -1; +static int hf_infiniband_RandomForwardingTable_LMC = -1; +static int hf_infiniband_RandomForwardingTable_Port = -1; + +/* MulticastForwardingTable */ +static int hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock = -1; +static int hf_infiniband_MulticastForwardingTable_PortMask = -1; + +/* SMInfo */ +static int hf_infiniband_SMInfo_GUID = -1; +static int hf_infiniband_SMInfo_SM_Key = -1; +static int hf_infiniband_SMInfo_ActCount = -1; +static int hf_infiniband_SMInfo_Priority = -1; +static int hf_infiniband_SMInfo_SMState = -1; + +/* VendorDiag */ +static int hf_infiniband_VendorDiag_NextIndex = -1; +static int hf_infiniband_VendorDiag_DiagData = -1; + +/* LedInfo */ +static int hf_infiniband_LedInfo_LedMask = -1; + +/* LinkSpeedWidthPairsTable */ +static int hf_infiniband_LinkSpeedWidthPairsTable_NumTables = -1; +static int hf_infiniband_LinkSpeedWidthPairsTable_PortMask = -1; +static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive = -1; +static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive = -1; +static int hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen = -1; + +/* Attributes for Subnet Administration. +* Mostly we have "Records" here which are just structures of SM attributes. +* There are some unique attributes though that we will want to have a structure for. */ + +/* NodeRecord */ +/* PortInfoRecord */ +/* SLtoVLMappingTableRecord */ +/* SwitchInfoRecord */ +/* LinearForwardingTableRecord */ +/* RandomForwardingTableRecord */ +/* MulticastForwardingTableRecord */ +/* VLArbitrationTableRecord */ +static int hf_infiniband_SA_LID = -1; +static int hf_infiniband_SA_EndportLID = -1; +static int hf_infiniband_SA_PortNum = -1; +static int hf_infiniband_SA_InputPortNum = -1; +static int hf_infiniband_SA_OutputPortNum = -1; +static int hf_infiniband_SA_BlockNum_EightBit = -1; +static int hf_infiniband_SA_BlockNum_NineBit = -1; +static int hf_infiniband_SA_BlockNum_SixteenBit = -1; +static int hf_infiniband_SA_Position = -1; +static int hf_infiniband_SA_Index = -1; +/* InformInfoRecord */ +static int hf_infiniband_InformInfoRecord_SubscriberGID = -1; +static int hf_infiniband_InformInfoRecord_Enum = -1; + +/* InformInfo */ +static int hf_infiniband_InformInfo_GID = -1; +static int hf_infiniband_InformInfo_LIDRangeBegin = -1; +static int hf_infiniband_InformInfo_LIDRangeEnd = -1; +static int hf_infiniband_InformInfo_IsGeneric = -1; +static int hf_infiniband_InformInfo_Subscribe = -1; +static int hf_infiniband_InformInfo_Type = -1; +static int hf_infiniband_InformInfo_TrapNumberDeviceID = -1; +static int hf_infiniband_InformInfo_QPN = -1; +static int hf_infiniband_InformInfo_RespTimeValue = -1; +static int hf_infiniband_InformInfo_ProducerTypeVendorID = -1; + +/* LinkRecord */ +static int hf_infiniband_LinkRecord_FromLID = -1; +static int hf_infiniband_LinkRecord_FromPort = -1; +static int hf_infiniband_LinkRecord_ToPort = -1; +static int hf_infiniband_LinkRecord_ToLID = -1; + +/* ServiceRecord */ +static int hf_infiniband_ServiceRecord_ServiceID = -1; +static int hf_infiniband_ServiceRecord_ServiceGID = -1; +static int hf_infiniband_ServiceRecord_ServiceP_Key = -1; +static int hf_infiniband_ServiceRecord_ServiceLease = -1; +static int hf_infiniband_ServiceRecord_ServiceKey = -1; +static int hf_infiniband_ServiceRecord_ServiceName = -1; +static int hf_infiniband_ServiceRecord_ServiceData = -1; + +/* ServiceAssociationRecord */ +static int hf_infiniband_ServiceAssociationRecord_ServiceKey = -1; +static int hf_infiniband_ServiceAssociationRecord_ServiceName = -1; + +/* PathRecord */ +static int hf_infiniband_PathRecord_DGID = -1; +static int hf_infiniband_PathRecord_SGID = -1; +static int hf_infiniband_PathRecord_DLID = -1; +static int hf_infiniband_PathRecord_SLID = -1; +static int hf_infiniband_PathRecord_RawTraffic = -1; +static int hf_infiniband_PathRecord_FlowLabel = -1; +static int hf_infiniband_PathRecord_HopLimit = -1; +static int hf_infiniband_PathRecord_TClass = -1; +static int hf_infiniband_PathRecord_Reversible = -1; +static int hf_infiniband_PathRecord_NumbPath = -1; +static int hf_infiniband_PathRecord_P_Key = -1; +static int hf_infiniband_PathRecord_SL = -1; +static int hf_infiniband_PathRecord_MTUSelector = -1; +static int hf_infiniband_PathRecord_MTU = -1; +static int hf_infiniband_PathRecord_RateSelector = -1; +static int hf_infiniband_PathRecord_Rate = -1; +static int hf_infiniband_PathRecord_PacketLifeTimeSelector = -1; +static int hf_infiniband_PathRecord_PacketLifeTime = -1; +static int hf_infiniband_PathRecord_Preference = -1; + +/* MCMemberRecord */ +static int hf_infiniband_MCMemberRecord_MGID = -1; +static int hf_infiniband_MCMemberRecord_PortGID = -1; +static int hf_infiniband_MCMemberRecord_Q_Key = -1; +static int hf_infiniband_MCMemberRecord_MLID = -1; +static int hf_infiniband_MCMemberRecord_MTUSelector = -1; +static int hf_infiniband_MCMemberRecord_MTU = -1; +static int hf_infiniband_MCMemberRecord_TClass = -1; +static int hf_infiniband_MCMemberRecord_P_Key = -1; +static int hf_infiniband_MCMemberRecord_RateSelector = -1; +static int hf_infiniband_MCMemberRecord_Rate = -1; +static int hf_infiniband_MCMemberRecord_PacketLifeTimeSelector = -1; +static int hf_infiniband_MCMemberRecord_PacketLifeTime = -1; +static int hf_infiniband_MCMemberRecord_SL = -1; +static int hf_infiniband_MCMemberRecord_FlowLabel = -1; +static int hf_infiniband_MCMemberRecord_HopLimit = -1; +static int hf_infiniband_MCMemberRecord_Scope = -1; +static int hf_infiniband_MCMemberRecord_JoinState = -1; +static int hf_infiniband_MCMemberRecord_ProxyJoin = -1; + +/* TraceRecord */ +static int hf_infiniband_TraceRecord_GIDPrefix = -1; +static int hf_infiniband_TraceRecord_IDGeneration = -1; +static int hf_infiniband_TraceRecord_NodeType = -1; +static int hf_infiniband_TraceRecord_NodeID = -1; +static int hf_infiniband_TraceRecord_ChassisID = -1; +static int hf_infiniband_TraceRecord_EntryPortID = -1; +static int hf_infiniband_TraceRecord_ExitPortID = -1; +static int hf_infiniband_TraceRecord_EntryPort = -1; +static int hf_infiniband_TraceRecord_ExitPort = -1; + +/* MultiPathRecord */ +static int hf_infiniband_MultiPathRecord_RawTraffic = -1; +static int hf_infiniband_MultiPathRecord_FlowLabel = -1; +static int hf_infiniband_MultiPathRecord_HopLimit = -1; +static int hf_infiniband_MultiPathRecord_TClass = -1; +static int hf_infiniband_MultiPathRecord_Reversible = -1; +static int hf_infiniband_MultiPathRecord_NumbPath = -1; +static int hf_infiniband_MultiPathRecord_P_Key = -1; +static int hf_infiniband_MultiPathRecord_SL = -1; +static int hf_infiniband_MultiPathRecord_MTUSelector = -1; +static int hf_infiniband_MultiPathRecord_MTU = -1; +static int hf_infiniband_MultiPathRecord_RateSelector = -1; +static int hf_infiniband_MultiPathRecord_Rate = -1; +static int hf_infiniband_MultiPathRecord_PacketLifeTimeSelector = -1; +static int hf_infiniband_MultiPathRecord_PacketLifeTime = -1; +static int hf_infiniband_MultiPathRecord_IndependenceSelector = -1; +static int hf_infiniband_MultiPathRecord_GIDScope = -1; +static int hf_infiniband_MultiPathRecord_SGIDCount = -1; +static int hf_infiniband_MultiPathRecord_DGIDCount = -1; +static int hf_infiniband_MultiPathRecord_SDGID = -1; + +/* Notice */ +static int hf_infiniband_Notice_IsGeneric = -1; +static int hf_infiniband_Notice_Type = -1; +static int hf_infiniband_Notice_ProducerTypeVendorID = -1; +static int hf_infiniband_Notice_TrapNumberDeviceID = -1; +static int hf_infiniband_Notice_IssuerLID = -1; +static int hf_infiniband_Notice_NoticeToggle = -1; +static int hf_infiniband_Notice_NoticeCount = -1; +static int hf_infiniband_Notice_DataDetails = -1; +static int hf_infiniband_Notice_IssuerGID = -1; +static int hf_infiniband_Notice_ClassTrapSpecificData = -1; + +/* Notice DataDetails and ClassTrapSpecific Data for certain traps +* Note that traps reuse many fields, so they are only declared once under the first trap that they appear. +* There is no need to redeclare them for specific Traps (as with other SA Attributes) because they are uniform between Traps. */ + +/* Parse DataDetails for a given Trap */ +static void parse_NoticeDataDetails(proto_tree*, tvbuff_t*, gint *offset, guint16 trapNumber); + +/* Traps 64,65,66,67 */ +static int hf_infiniband_Trap_GIDADDR = -1; + +/* Traps 68,69 */ +/* DataDetails */ +static int hf_infiniband_Trap_COMP_MASK = -1; +static int hf_infiniband_Trap_WAIT_FOR_REPATH = -1; +/* ClassTrapSpecificData */ +static int hf_infiniband_Trap_PATH_REC = -1; + +/* Trap 128 */ +static int hf_infiniband_Trap_LIDADDR = -1; + +/* Trap 129, 130, 131 */ +static int hf_infiniband_Trap_PORTNO = -1; + +/* Trap 144 */ +static int hf_infiniband_Trap_OtherLocalChanges = -1; +static int hf_infiniband_Trap_CAPABILITYMASK = -1; +static int hf_infiniband_Trap_LinkSpeecEnabledChange = -1; +static int hf_infiniband_Trap_LinkWidthEnabledChange = -1; +static int hf_infiniband_Trap_NodeDescriptionChange = -1; + +/* Trap 145 */ +static int hf_infiniband_Trap_SYSTEMIMAGEGUID = -1; + +/* Trap 256 */ +static int hf_infiniband_Trap_DRSLID = -1; +static int hf_infiniband_Trap_METHOD = -1; +static int hf_infiniband_Trap_ATTRIBUTEID = -1; +static int hf_infiniband_Trap_ATTRIBUTEMODIFIER = -1; +static int hf_infiniband_Trap_MKEY = -1; +static int hf_infiniband_Trap_DRNotice = -1; +static int hf_infiniband_Trap_DRPathTruncated = -1; +static int hf_infiniband_Trap_DRHopCount = -1; +static int hf_infiniband_Trap_DRNoticeReturnPath = -1; + +/* Trap 257, 258 */ +static int hf_infiniband_Trap_LIDADDR1 = -1; +static int hf_infiniband_Trap_LIDADDR2 = -1; +static int hf_infiniband_Trap_KEY = -1; +static int hf_infiniband_Trap_SL = -1; +static int hf_infiniband_Trap_QP1 = -1; +static int hf_infiniband_Trap_QP2 = -1; +static int hf_infiniband_Trap_GIDADDR1 = -1; +static int hf_infiniband_Trap_GIDADDR2 = -1; + +/* Trap 259 */ +static int hf_infiniband_Trap_DataValid = -1; +static int hf_infiniband_Trap_PKEY = -1; +static int hf_infiniband_Trap_SWLIDADDR = -1; + +/* Trap Type/Descriptions for dissection */ +static const value_string Trap_Description[]= { + { 64, " (Informational) <GIDADDR> is now in service"}, + { 65, " (Informational) <GIDADDR> is out of service"}, + { 66, " (Informational) New Multicast Group with multicast address <GIDADDR> is now created"}, + { 67, " (Informational) Multicast Group with multicast address <GIDADDR> is now deleted"}, + { 68, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> are no longer valid"}, + { 69, " (Informational) Paths indicated by <PATH_REC> and <COMP_MASK> have been recomputed"}, + { 128, " (Urgent) Link State of at least one port of switch at <LIDADDR> has changed"}, + { 129, " (Urgent) Local Link Integrity threshold reached at <LIDADDR><PORTNO>"}, + { 130, " (Urgent) Excessive Buffer OVerrun threshold reached at <LIDADDR><PORTNO>"}, + { 131, " (Urgent) Flow Control Update watchdog timer expired at <LIDADDR><PORTNO>"}, + { 144, " (Informational) CapMask, NodeDesc, LinkWidthEnabled or LinkSpeedEnabled at <LIDADDR> has been modified"}, + { 145, " (Informational) SystemImageGUID at <LIDADDR> has been modified. New value is <SYSTEMIMAGEGUID>"}, + { 256, " (Security) Bad M_Key, <M_KEY> from <LIDADDR> attempted <METHOD> with <ATTRIBUTEID> and <ATTRIBUTEMODIFIER>"}, + { 257, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"}, + { 258, " (Security) Bad Q_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL>"}, + { 259, " (Security) Bad P_Key, <KEY> from <LIDADDR1><GIDADDR1><QP1> to <LIDADDR2><GIDADDR2><QP2> on <SL> at switch <LIDADDR><PORTNO>"} +}; + + + + +/* MAD Management Classes +* Classes from the Common MAD Header +* +* Management Class Name Class Description +* ------------------------------------------------------------------------------------------------------------ */ +#define SUBN_LID_ROUTED 0x01 /* Subnet Management LID Route */ +#define SUBN_DIRECTED_ROUTE 0x81 /* Subnet Management Directed Route */ +#define SUBNADMN 0x03 /* Subnet Administration */ +#define PERF 0x04 /* Performance Management */ +#define BM 0x05 /* Baseboard Management (Tunneling of IB-ML commands through the IBA subnet) */ +#define DEV_MGT 0x06 /* Device Management */ +#define COM_MGT 0x07 /* Communications Management */ +#define SNMP 0x08 /* SNMP Tunneling (tunneling of the SNMP protocol through the IBA fabric) */ +#define VENDOR_1_START 0x09 /* Start of first Vendor Specific Range */ +#define VENDOR_1_END 0x0F /* End of first Vendor Specific Range */ +#define VENDOR_2_START 0x30 /* Start of second Vendor Specific Range */ +#define VENDOR_2_END 0x4F /* End of the second Vendor Specific Range */ +#define APPLICATION_START 0x10 /* Start of Application Specific Range */ +#define APPLICATION_END 0x2F /* End of Application Specific Range */ /* Link Next Header Values */ #define IBA_GLOBAL 3 @@ -151,12 +943,12 @@ static int hf_infiniband_vendor = -1; #define IP_NON_IBA 1 #define RAW 0 -/* OpCodeValues */ -/* Code Bits [7-5] Connection Type */ -/* [4-0] Message Type */ +/* OpCodeValues +* Code Bits [7-5] Connection Type +* [4-0] Message Type -/* Reliable Connection (RC) */ -/* [7-5] = 000 */ +* Reliable Connection (RC) +* [7-5] = 000 */ #define RC_SEND_FIRST 0 /*0x00000000 */ #define RC_SEND_MIDDLE 1 /*0x00000001 */ #define RC_SEND_LAST 2 /*0x00000010 */ @@ -181,8 +973,8 @@ static int hf_infiniband_vendor = -1; #define RC_SEND_LAST_INVAL 22 /*0x00010110 */ #define RC_SEND_ONLY_INVAL 23 /*0x00010111 */ -/* Reliable Datagram (RD) */ -/* [7-5] = 010 */ +/* Reliable Datagram (RD) +* [7-5] = 010 */ #define RD_SEND_FIRST 64 /*0x01000000 */ #define RD_SEND_MIDDLE 65 /*0x01000001 */ #define RD_SEND_LAST 66 /*0x01000010 */ @@ -206,13 +998,13 @@ static int hf_infiniband_vendor = -1; #define RD_FETCH_ADD 84 /*0x01010100 */ #define RD_RESYNC 85 /*0x01010101 */ -/* Unreliable Datagram (UD) */ -/* [7-5] = 011 */ +/* Unreliable Datagram (UD) +* [7-5] = 011 */ #define UD_SEND_ONLY 100 /*0x01100100 */ #define UD_SEND_ONLY_IMM 101 /*0x01100101 */ -/* Unreliable Connection (UC) */ -/* [7-5] = 001 */ +/* Unreliable Connection (UC) +* [7-5] = 001 */ #define UC_SEND_FIRST 32 /*0x00100000 */ #define UC_SEND_MIDDLE 33 /*0x00100001 */ #define UC_SEND_LAST 34 /*0x00100010 */ @@ -228,82 +1020,82 @@ static int hf_infiniband_vendor = -1; static value_string OpCodeMap[] = { - { RC_SEND_FIRST, "Reliable Connection Send First" }, - { RC_SEND_MIDDLE, "Reliable Connection Send Middle"}, - { RC_SEND_LAST, "Reliable Connection Send Last" }, - { RC_SEND_LAST_IMM, "Reliable Connection Send Last Immediate"}, - { RC_SEND_ONLY, "Reliable Connection Send Only"}, - { RC_SEND_ONLY_IMM, "Reliable Connection Send Only Immediate"}, - { RC_RDMA_WRITE_FIRST, "Reliable Connection RDMA Write First" }, - { RC_RDMA_WRITE_MIDDLE, "Reliable Connection RDMA Write Middle"}, - { RC_RDMA_WRITE_LAST, "Reliable Connection RDMA Write Last"}, - { RC_RDMA_WRITE_LAST_IMM, "Reliable Connection RDMA Write Last Immediate " }, - { RC_RDMA_WRITE_ONLY, "Reliable Connection RDMA Write Only" }, - { RC_RDMA_WRITE_ONLY_IMM, "Reliable Connection RDMA Write Only Immediate"}, - { RC_RDMA_READ_REQUEST, "Reliable Connection RDMA Read Request" }, - { RC_RDMA_READ_RESPONSE_FIRST, "Reliable Connection RDMA Read Response First" }, - { RC_RDMA_READ_RESPONSE_MIDDLE, "Reliable Connection RDMA Read Response Middle"}, - { RC_RDMA_READ_RESPONSE_LAST, "Reliable Connection RDMA Read Response Last" }, - { RC_RDMA_READ_RESPONSE_ONLY, "Reliable Connection RDMA Read Response Only"}, - { RC_ACKNOWLEDGE, "Reliable Connection Acknowledge" }, - { RC_ATOMIC_ACKNOWLEDGE, "Reliable Connection Atomic Acknowledge" }, - { RC_CMP_SWAP, "Reliable Connection Compare Swap" }, - { RC_FETCH_ADD, "Reliable Connection Fetch Add"}, - { RC_SEND_LAST_INVAL, "Reliable Connection Send Last Invalidate"}, - { RC_SEND_ONLY_INVAL, "Reliable Connection Send Only Invalidate" }, - - - { RD_SEND_FIRST, "Reliable Datagram Send First"}, - { RD_SEND_MIDDLE,"Reliable Datagram Send Middle" }, - { RD_SEND_LAST, "Reliable Datagram Send Last"}, - { RD_SEND_LAST_IMM, "Reliable Datagram Last Immediate" }, - { RD_SEND_ONLY,"Reliable Datagram Send Only"}, - { RD_SEND_ONLY_IMM,"Reliable Datagram Send Only Immediate"}, - { RD_RDMA_WRITE_FIRST,"Reliable Datagram RDMA Write First"}, - { RD_RDMA_WRITE_MIDDLE, "Reliable Datagram RDMA Write Middle"}, - { RD_RDMA_WRITE_LAST,"Reliable Datagram RDMA Write Last"}, - { RD_RDMA_WRITE_LAST_IMM,"Reliable Datagram RDMA Write Last Immediate"}, - { RD_RDMA_WRITE_ONLY,"Reliable Datagram RDMA Write Only"}, - { RD_RDMA_WRITE_ONLY_IMM,"Reliable Datagram RDMA Write Only Immediate"}, - { RD_RDMA_READ_REQUEST,"Reliable Datagram RDMA Read Request"}, - { RD_RDMA_READ_RESPONSE_FIRST,"Reliable Datagram RDMA Read Response First"}, - { RD_RDMA_READ_RESPONSE_MIDDLE,"Reliable Datagram RDMA Read Response Middle"}, - { RD_RDMA_READ_RESPONSE_LAST,"Reliable Datagram RDMA Read Response Last"}, - { RD_RDMA_READ_RESPONSE_ONLY,"Reliable Datagram RDMA Read Response Only"}, - { RD_ACKNOWLEDGE,"Reliable Datagram Acknowledge"}, - { RD_ATOMIC_ACKNOWLEDGE,"Reliable Datagram Atomic Acknowledge"}, - { RD_CMP_SWAP,"Reliable Datagram Compare Swap"}, - { RD_FETCH_ADD, "Reliable Datagram Fetch Add"}, - { RD_RESYNC,"Reliable Datagram RESYNC"}, - - - { UD_SEND_ONLY, "Unreliable Datagram Send Only"}, - { UD_SEND_ONLY_IMM, "Unreliable Datagram Send Only Immediate"}, - - - { UC_SEND_FIRST,"Unreliable Connection Send First"}, - { UC_SEND_MIDDLE,"Unreliable Connection Send Middle"}, - { UC_SEND_LAST,"Unreliable Connection Send Last"}, - { UC_SEND_LAST_IMM,"Unreliable Connection Send Last Immediate"}, - { UC_SEND_ONLY,"Unreliable Connection Send Only"}, - { UC_SEND_ONLY_IMM,"Unreliable Connection Send Only Immediate"}, - { UC_RDMA_WRITE_FIRST,"Unreliable Connection RDMA Write First"}, - { UC_RDMA_WRITE_MIDDLE,"Unreliable Connection RDMA Write Middle"}, - { UC_RDMA_WRITE_LAST,"Unreliable Connection RDMA Write Last"}, - { UC_RDMA_WRITE_LAST_IMM,"Unreliable Connection RDMA Write Last Immediate"}, - { UC_RDMA_WRITE_ONLY,"Unreliable Connection RDMA Write Only"}, - { UC_RDMA_WRITE_ONLY_IMM,"Unreliable Connection RDMA Write Only Immediate"}, - { 0, NULL } - -}; - - - -/* Header Ordering Based on OPCODES */ -/* These are simply an enumeration of the possible header combinations defined by the IB Spec. */ -/* These enumerations */ -/* #DEFINE [HEADER_ORDER] [ENUM] */ -/* __________________________________ */ + { RC_SEND_FIRST, "RC Send First " }, + { RC_SEND_MIDDLE, "RC Send Middle "}, + { RC_SEND_LAST, "RC Send Last " }, + { RC_SEND_LAST_IMM, "RC Send Last Immediate "}, + { RC_SEND_ONLY, "RC Send Only "}, + { RC_SEND_ONLY_IMM, "RC Send Only Immediate "}, + { RC_RDMA_WRITE_FIRST, "RC RDMA Write First " }, + { RC_RDMA_WRITE_MIDDLE, "RC RDMA Write Middle "}, + { RC_RDMA_WRITE_LAST, "RC RDMA Write Last "}, + { RC_RDMA_WRITE_LAST_IMM, "RC RDMA Write Last Immediate " }, + { RC_RDMA_WRITE_ONLY, "RC RDMA Write Only " }, + { RC_RDMA_WRITE_ONLY_IMM, "RC RDMA Write Only Immediate "}, + { RC_RDMA_READ_REQUEST, "RC RDMA Read Request " }, + { RC_RDMA_READ_RESPONSE_FIRST, "RC RDMA Read Response First " }, + { RC_RDMA_READ_RESPONSE_MIDDLE, "RC RDMA Read Response Middle "}, + { RC_RDMA_READ_RESPONSE_LAST, "RC RDMA Read Response Last " }, + { RC_RDMA_READ_RESPONSE_ONLY, "RC RDMA Read Response Only "}, + { RC_ACKNOWLEDGE, "RC Acknowledge " }, + { RC_ATOMIC_ACKNOWLEDGE, "RC Atomic Acknowledge " }, + { RC_CMP_SWAP, "RC Compare Swap " }, + { RC_FETCH_ADD, "RC Fetch Add "}, + { RC_SEND_LAST_INVAL, "RC Send Last Invalidate "}, + { RC_SEND_ONLY_INVAL, "RC Send Only Invalidate " }, + + + { RD_SEND_FIRST, "RD Send First "}, + { RD_SEND_MIDDLE,"RD Send Middle " }, + { RD_SEND_LAST, "RD Send Last "}, + { RD_SEND_LAST_IMM, "RD Last Immediate " }, + { RD_SEND_ONLY,"RD Send Only "}, + { RD_SEND_ONLY_IMM,"RD Send Only Immediate "}, + { RD_RDMA_WRITE_FIRST,"RD RDMA Write First "}, + { RD_RDMA_WRITE_MIDDLE, "RD RDMA Write Middle "}, + { RD_RDMA_WRITE_LAST,"RD RDMA Write Last "}, + { RD_RDMA_WRITE_LAST_IMM,"RD RDMA Write Last Immediate "}, + { RD_RDMA_WRITE_ONLY,"RD RDMA Write Only "}, + { RD_RDMA_WRITE_ONLY_IMM,"RD RDMA Write Only Immediate "}, + { RD_RDMA_READ_REQUEST,"RD RDMA Read Request "}, + { RD_RDMA_READ_RESPONSE_FIRST,"RD RDMA Read Response First "}, + { RD_RDMA_READ_RESPONSE_MIDDLE,"RD RDMA Read Response Middle "}, + { RD_RDMA_READ_RESPONSE_LAST,"RD RDMA Read Response Last "}, + { RD_RDMA_READ_RESPONSE_ONLY,"RD RDMA Read Response Only "}, + { RD_ACKNOWLEDGE,"RD Acknowledge "}, + { RD_ATOMIC_ACKNOWLEDGE,"RD Atomic Acknowledge "}, + { RD_CMP_SWAP,"RD Compare Swap "}, + { RD_FETCH_ADD, "RD Fetch Add "}, + { RD_RESYNC,"RD RESYNC "}, + + + { UD_SEND_ONLY, "UD Send Only "}, + { UD_SEND_ONLY_IMM, "UD Send Only Immediate "}, + + + { UC_SEND_FIRST,"UC Send First "}, + { UC_SEND_MIDDLE,"UC Send Middle "}, + { UC_SEND_LAST,"UC Send Last "}, + { UC_SEND_LAST_IMM,"UC Send Last Immediate "}, + { UC_SEND_ONLY,"UC Send Only "}, + { UC_SEND_ONLY_IMM,"UC Send Only Immediate "}, + { UC_RDMA_WRITE_FIRST,"UC RDMA Write First"}, + { UC_RDMA_WRITE_MIDDLE,"Unreliable Connection RDMA Write Middle "}, + { UC_RDMA_WRITE_LAST,"UC RDMA Write Last "}, + { UC_RDMA_WRITE_LAST_IMM,"UC RDMA Write Last Immediate "}, + { UC_RDMA_WRITE_ONLY,"UC RDMA Write Only "}, + { UC_RDMA_WRITE_ONLY_IMM,"UC RDMA Write Only Immediate "}, + { 0, NULL} + +}; + + + +/* Header Ordering Based on OPCODES +* These are simply an enumeration of the possible header combinations defined by the IB Spec. +* These enumerations +* #DEFINE [HEADER_ORDER] [ENUM] +* __________________________________ */ #define RDETH_DETH_PAYLD 0 /* __________________________________ */ #define RDETH_DETH_RETH_PAYLD 1 @@ -352,9 +1144,9 @@ static value_string OpCodeMap[] = /* ___________________________________ */ -/* Array of all availavle OpCodes to make matching a bit easier. */ -/* The OpCodes dictate the header sequence following in the packet. */ -/* These arrays tell the dissector which headers must be decoded for the given OpCode. */ +/* Array of all availavle OpCodes to make matching a bit easier. +* The OpCodes dictate the header sequence following in the packet. +* These arrays tell the dissector which headers must be decoded for the given OpCode. */ static guint32 opCode_RDETH_DETH_ATOMICETH[] = { RD_CMP_SWAP, RD_FETCH_ADD @@ -432,50 +1224,50 @@ static guint32 opCode_PAYLD[] = { UC_RDMA_WRITE_LAST }; -/* It is not necessary to create arrays for these OpCodes since they indicate only one further header. */ -/* We can just decode it directly */ - -/*static guint32 opCode_DETH_IMMDT_PAYLD[] = { */ -/* UD_SEND_ONLY_IMM */ -/*}; */ -/*static guint32 opCode_DETH_PAYLD[] = { */ -/* UD_SEND_ONLY */ -/*}; */ -/*static guint32 opCode_RDETH_DETH[] = { */ -/* RD_RESYNC */ -/*}; */ -/*static guint32 opCode_RDETH_DETH_RETH[] = { */ -/* RD_RDMA_READ_REQUEST */ -/*}; */ -/*static guint32 opCode_RDETH_DETH_RETH_IMMDT_PAYLD[] = { */ -/* RD_RDMA_WRITE_ONLY_IMM */ -/*}; */ -/*static guint32 opCode_RDETH_AETH_ATOMICACKETH[] = { */ -/* RD_ATOMIC_ACKNOWLEDGE */ -/*}; */ -/*static guint32 opCode_RDETH_AETH[] = { */ -/* RD_ACKNOWLEDGE */ -/*}; */ -/*static guint32 opCode_RDETH_PAYLD[] = { */ -/* RD_RDMA_READ_RESPONSE_MIDDLE */ -/*}; */ -/*static guint32 opCode_AETH_ATOMICACKETH[] = { */ -/* RC_ATOMIC_ACKNOWLEDGE */ -/*}; */ -/*static guint32 opCode_RETH[] = { */ -/* RC_RDMA_READ_REQUEST */ -/*}; */ -/*static guint32 opCode_AETH[] = { */ -/* RC_ACKNOWLEDGE */ -/*}; */ - - -/* Field dissector structures. */ -/* For reserved fields, reservedX denotes the reserved field is X bits in length. */ -/* e.g. reserved2 is a reserved field 2 bits in length. */ -/* The third parameter is a filter string associated for this field. */ -/* So for instance, to filter packets for a given virtual lane, */ -/* The filter (infiniband.LRH.vl == 3) or something similar would be used. */ +/* It is not necessary to create arrays for these OpCodes since they indicate only one further header. +* We can just decode it directly + +* static guint32 opCode_DETH_IMMDT_PAYLD[] = { +* UD_SEND_ONLY_IMM +* }; +* static guint32 opCode_DETH_PAYLD[] = { +* UD_SEND_ONLY +* }; +* static guint32 opCode_RDETH_DETH[] = { +* RD_RESYNC +* }; +* static guint32 opCode_RDETH_DETH_RETH[] = { +* RD_RDMA_READ_REQUEST +* }; +* static guint32 opCode_RDETH_DETH_RETH_IMMDT_PAYLD[] = { +* RD_RDMA_WRITE_ONLY_IMM +* }; +* static guint32 opCode_RDETH_AETH_ATOMICACKETH[] = { +* RD_ATOMIC_ACKNOWLEDGE +* }; +* static guint32 opCode_RDETH_AETH[] = { +* RD_ACKNOWLEDGE +* }; +* static guint32 opCode_RDETH_PAYLD[] = { +* RD_RDMA_READ_RESPONSE_MIDDLE +* }; +* static guint32 opCode_AETH_ATOMICACKETH[] = { +* RC_ATOMIC_ACKNOWLEDGE +* }; +* static guint32 opCode_RETH[] = { +* RC_RDMA_READ_REQUEST +* }; +* static guint32 opCode_AETH[] = { +* RC_ACKNOWLEDGE +* }; */ + + +/* Field dissector structures. +* For reserved fields, reservedX denotes the reserved field is X bits in length. +* e.g. reserved2 is a reserved field 2 bits in length. +* The third parameter is a filter string associated for this field. +* So for instance, to filter packets for a given virtual lane, +* The filter (infiniband.LRH.vl == 3) or something similar would be used. */ static hf_register_info hf[] = { @@ -534,10 +1326,10 @@ static hf_register_info hf[] = { {"Hop Limit", "infiniband.grh.hoplmt", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL} }, {&hf_infiniband_source_gid, - {"Source GID", "infiniband.grh.sgid", FT_BYTES, BASE_DEC, NULL, 0x0, NULL, HFILL} + {"Source GID", "infiniband.grh.sgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL} }, {&hf_infiniband_destination_gid, - {"Destination GID", "infiniband.grh.dgid", FT_BYTES, BASE_DEC, NULL, 0x0, NULL, HFILL} + {"Destination GID", "infiniband.grh.dgid", FT_IPv6, BASE_DEC, NULL, 0x0, NULL, HFILL} }, /* Base Transport Header (BTH) */ @@ -578,6 +1370,17 @@ static hf_register_info hf[] = { {"Packet Sequence Number", "infiniband.bth.psn", FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL} }, + /* Raw Header (RWH) */ + {&hf_infiniband_RWH, + {"Raw Header", "infiniband.rwh", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_reserved16_RWH, + {"Reserved (16 bits)", "infiniband.rwh.reserved", FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_etype, + {"Ethertype", "infiniband.rwh.etype", FT_UINT16, BASE_HEX, NULL /*VALS(etype_vals)*/, 0x0, "Type", HFILL } + }, + /* Reliable Datagram Extended Transport Header (RDETH) */ {&hf_infiniband_RDETH, {"Reliable Datagram Extentded Transport Header", "infiniband.rdeth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} @@ -608,13 +1411,13 @@ static hf_register_info hf[] = { {"RDMA Extended Transport Header", "infiniband.reth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} }, {&hf_infiniband_virtual_address, - {"Virtual Address", "infiniband.reth.va", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL} + {"Virtual Address", "infiniband.reth.va", FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL} }, {&hf_infiniband_remote_key, - {"Remote Key", "infiniband.reth.r_key", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL} + {"Remote Key", "infiniband.reth.r_key", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL} }, {&hf_infiniband_dma_length, - {"DMA Length", "infiniband.reth.dmalen", FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL} + {"DMA Length", "infiniband.reth.dmalen", FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL} }, /* Atomic Extended Transport Header (AtomicETH) */ @@ -656,10 +1459,12 @@ static hf_register_info hf[] = { {&hf_infiniband_IMMDT, {"Immediate Data", "infiniband.immdt", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} }, + /* Invalidate Extended Transport Header (IETH) */ {&hf_infiniband_IETH, {"RKey", "infiniband.ieth", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} }, + /* Payload */ {&hf_infiniband_payload, {"Payload", "infiniband.payload", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} @@ -676,12 +1481,1054 @@ static hf_register_info hf[] = { /* Unknown or Vendor Specific */ {&hf_infiniband_vendor, {"Unknown/Vendor Specific Data", "infiniband.vendor", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} - } + }, + + /* MAD Base Header */ + {&hf_infiniband_MAD, + {"MAD (Management Datagram) Common Header", "infiniband.mad", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_base_version, + {"Base Version", "infiniband.mad.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_mgmt_class, + {"Management Class", "infiniband.mad.mgmtclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_class_version, + {"Class Version", "infiniband.mad.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_reserved1, + {"Reserved", "infiniband.mad.reserved1", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_method, + {"Method", "infiniband.mad.method", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL} + }, + {&hf_infiniband_status, + {"Status", "infiniband.mad.status", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_class_specific, + {"Class Specific", "infiniband.mad.classspecific", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_transaction_id, + {"Transaction ID", "infiniband.mad.transactionid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_attribute_id, + {"Attribute ID", "infiniband.mad.attributeid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_reserved16, + {"Reserved", "infiniband.mad.reserved16", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_attribute_modifier, + {"Attribute Modifier", "infiniband.mad.attributemodifier", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_data, + {"MAD Data Payload", "infiniband.mad.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* RMPP Header */ + {&hf_infiniband_RMPP, + {"RMPP (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_rmpp_version, + {"RMPP Type", "infiniband.rmpp.rmppversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_rmpp_type, + {"RMPP Type", "infiniband.rmpp.rmpptype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_r_resp_time, + {"R Resp Time", "infiniband.rmpp.rresptime", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_rmpp_flags, + {"RMPP Flags", "infiniband.rmpp.rmppflags", FT_UINT8, BASE_HEX, VALS(RMPP_Flags), 0x0F, NULL, HFILL} + }, + {&hf_infiniband_rmpp_status, + {"RMPP Status", "infiniband.rmpp.rmppstatus", FT_UINT8, BASE_HEX, VALS(RMPP_Status), 0x0, NULL, HFILL} + }, + {&hf_infiniband_rmpp_data1, + {"RMPP Data 1", "infiniband.rmpp.data1", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_rmpp_data2, + {"RMPP Data 2", "infiniband.rmpp.data2", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* RMPP Data */ + {&hf_infiniband_RMPP_DATA, + {"RMPP Data (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp.data", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_segment_number, + {"Segment Number", "infiniband.rmpp.segmentnumber", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_payload_length32, + {"Payload Length", "infiniband.rmpp.payloadlength", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_transferred_data, + {"Transferred Data", "infiniband.rmpp.transferreddata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* RMPP ACK */ + {&hf_infiniband_new_window_last, + {"New Window Last", "infiniband.rmpp.newwindowlast", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_reserved220, + {"Segment Number", "infiniband.rmpp.reserved220", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* RMPP ABORT/STOP */ + {&hf_infiniband_optional_extended_error_data, + {"Optional Extended Error Data", "infiniband.rmpp.extendederrordata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* SMP Data (LID Routed) */ + {&hf_infiniband_SMP_LID, + {"Subnet Management Packet (LID Routed)", "infiniband.smplid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_m_key, + {"M_Key", "infiniband.smplid.mkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_smp_data, + {"SMP Data", "infiniband.smplid.smpdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_reserved1024, + {"Reserved (1024 bits)", "infiniband.smplid.reserved1024", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_reserved256, + {"Reserved (256 bits)", "infiniband.smplid.reserved256", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* SMP Data Directed Route */ + {&hf_infiniband_SMP_DIRECTED, + {"Subnet Management Packet (Directed Route)", "infiniband.smpdirected", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_smp_status, + {"Status", "infiniband.smpdirected.smpstatus", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_hop_pointer, + {"Hop Pointer", "infiniband.smpdirected.hoppointer", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_hop_count, + {"Hop Count", "infiniband.smpdirected.hopcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_dr_slid, + {"DrSLID", "infiniband.smpdirected.drslid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_dr_dlid, + {"DrDLID", "infiniband.smpdirected.drdlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_reserved28, + {"Reserved (224 bits)", "infiniband.smpdirected.reserved28", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_d, + {"D (Direction Bit)", "infiniband.smpdirected.d", FT_UINT64, BASE_HEX, NULL, 0x8000, NULL, HFILL} + }, + {&hf_infiniband_initial_path, + {"Initial Path", "infiniband.smpdirected.initialpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_return_path, + {"Return Path", "infiniband.smpdirected.returnpath", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* SA MAD Header */ + {&hf_infiniband_SA, + {"SA Packet (Subnet Administration)", "infiniband.sa.drdlid", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_sm_key, + {"SM_Key (Verification Key)", "infiniband.sa.smkey", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_attribute_offset, + {"Attribute Offset", "infiniband.sa.attributeoffset", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_component_mask, + {"Component Mask", "infiniband.sa.componentmask", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_subnet_admin_data, + {"Subnet Admin Data", "infiniband.sa.subnetadmindata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* NodeDescription */ + {&hf_infiniband_NodeDescription_NodeString, + {"NodeString", "infiniband.nodedescription.nodestring", FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* NodeInfo */ + {&hf_infiniband_NodeInfo_BaseVersion, + {"BaseVersion", "infiniband.nodeinfo.baseversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_NodeInfo_ClassVersion, + {"ClassVersion", "infiniband.nodeinfo.classversion", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_NodeInfo_NodeType, + {"NodeType", "infiniband.nodeinfo.nodetype", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_NodeInfo_NumPorts, + {"NumPorts", "infiniband.nodeinfo.numports", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_NodeInfo_SystemImageGUID, + {"SystemImageGUID", "infiniband.nodeinfo.systemimageguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_NodeInfo_NodeGUID, + {"NodeGUID", "infiniband.nodeinfo.nodeguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_NodeInfo_PortGUID, + {"PortGUID", "infiniband.nodeinfo.portguid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_NodeInfo_PartitionCap, + {"PartitionCap", "infiniband.nodeinfo.partitioncap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_NodeInfo_DeviceID, + {"DeviceID", "infiniband.nodeinfo.deviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_NodeInfo_Revision, + {"Revision", "infiniband.nodeinfo.revision", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_NodeInfo_LocalPortNum, + {"LocalPortNum", "infiniband.nodeinfo.localportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_NodeInfo_VendorID, + {"VendorID", "infiniband.nodeinfo.vendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* SwitchInfo */ + {&hf_infiniband_SwitchInfo_LinearFDBCap, + {"LinearFDBCap", "infiniband.switchinfo.linearfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_RandomFDBCap, + {"RandomFDBCap", "infiniband.switchinfo.randomfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_MulticastFDBCap, + {"MulticastFDBCap", "infiniband.switchinfo.multicastfdbcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_LinearFDBTop, + {"LinearFDBTop", "infiniband.switchinfo.linearfdbtop", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_DefaultPort, + {"DefaultPort", "infiniband.switchinfo.defaultport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort, + {"DefaultMulticastPrimaryPort", "infiniband.switchinfo.defaultmulticastprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort, + {"DefaultMulticastNotPrimaryPort", "infiniband.switchinfo.defaultmulticastnotprimaryport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_LifeTimeValue, + {"LifeTimeValue", "infiniband.switchinfo.lifetimevalue", FT_UINT8, BASE_HEX, NULL, 0xF8, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_PortStateChange, + {"PortStateChange", "infiniband.switchinfo.portstatechange", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming, + {"OptimizedSLtoVLMappingProgramming", "infiniband.switchinfo.optimizedsltovlmappingprogramming", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_LIDsPerPort, + {"LIDsPerPort", "infiniband.switchinfo.lidsperport", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_PartitionEnforcementCap, + {"PartitionEnforcementCap", "infiniband.switchinfo.partitionenforcementcap", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_InboundEnforcementCap, + {"InboundEnforcementCap", "infiniband.switchinfo.inboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_OutboundEnforcementCap, + {"OutboundEnforcementCap", "infiniband.switchinfo.outboundenforcementcap", FT_UINT8, BASE_HEX, NULL, 0x40, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_FilterRawInboundCap, + {"FilterRawInboundCap", "infiniband.switchinfo.filterrawinboundcap", FT_UINT8, BASE_HEX, NULL, 0x20, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_FilterRawOutboundCap, + {"FilterRawOutboundCap", "infiniband.switchinfo.filterrawoutboundcap", FT_UINT8, BASE_HEX, NULL, 0x10, NULL, HFILL} + }, + {&hf_infiniband_SwitchInfo_EnhancedPortZero, + {"EnhancedPortZero", "infiniband.switchinfo.enhancedportzero", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL} + }, + /* GUIDInfo */ + {&hf_infiniband_GUIDInfo_GUIDBlock, + {"GUIDBlock", "infiniband.switchinfo.guidblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_GUIDInfo_GUID, + {"GUID", "infiniband.switchinfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* PortInfo */ + {&hf_infiniband_PortInfo_M_Key, + {"M_Key", "infiniband.portinfo.m_key", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_GidPrefix, + {"GidPrefix", "infiniband.portinfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LID, + {"LID", "infiniband.portinfo.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_MasterSMLID, + {"MasterSMLID", "infiniband.portinfo.mastersmlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask, + {"CapabilityMask", "infiniband.portinfo.capabilitymask", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + + /* Capability Mask Flags */ + {&hf_infiniband_PortInfo_CapabilityMask_SM, + {"SM", "infiniband.portinfo.capabilitymask.issm", FT_UINT32, BASE_HEX, NULL, 0x0000002, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_NoticeSupported, + {"NoticeSupported", "infiniband.portinfo.capabilitymask.noticesupported", FT_UINT32, BASE_HEX, NULL, 0x0000004, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_TrapSupported, + {"TrapSupported", "infiniband.portinfo.capabilitymask.trapsupported", FT_UINT32, BASE_HEX, NULL, 0x0000008, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported, + {"OptionalPDSupported", "infiniband.portinfo.capabilitymask.optionalpdsupported", FT_UINT32, BASE_HEX, NULL, 0x0000010, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported, + {"AutomaticMigrationSupported", "infiniband.portinfo.capabilitymask.automaticmigrationsupported", FT_UINT32, BASE_HEX, NULL, 0x0000020, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported, + {"SLMappingSupported", "infiniband.portinfo.capabilitymask.slmappingsupported", FT_UINT32, BASE_HEX, NULL, 0x0000040, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM, + {"MKeyNVRAM", "infiniband.portinfo.capabilitymask.mkeynvram", FT_UINT32, BASE_HEX, NULL, 0x0000080, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM, + {"PKeyNVRAM", "infiniband.portinfo.capabilitymask.pkeynvram", FT_UINT32, BASE_HEX, NULL, 0x0000100, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported, + {"LEDInfoSupported", "infiniband.portinfo.capabilitymask.ledinfosupported", FT_UINT32, BASE_HEX, NULL, 0x0000200, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_SMdisabled, + {"SMdisabled", "infiniband.portinfo.capabilitymask.smdisabled", FT_UINT32, BASE_HEX, NULL, 0x0000400, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported, + {"SystemImageGUIDSupported", "infiniband.portinfo.capabilitymask.systemimageguidsupported", FT_UINT32, BASE_HEX, NULL, 0x0000800, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported, + {"PKeySwitchExternalPortTrapSupported", "infiniband.portinfo.capabilitymask.pkeyswitchexternalporttrapsupported", FT_UINT32, BASE_HEX, NULL, 0x0001000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported, + {"CommunicationsManagementSupported", "infiniband.portinfo.capabilitymask.communicationsmanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0010000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported, + {"SNMPTunnelingSupported", "infiniband.portinfo.capabilitymask.snmptunnelingsupported", FT_UINT32, BASE_HEX, NULL, 0x0020000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_ReinitSupported, + {"ReinitSupported", "infiniband.portinfo.capabilitymask.reinitsupported", FT_UINT32, BASE_HEX, NULL, 0x0040000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported, + {"DeviceManagementSupported", "infiniband.portinfo.capabilitymask.devicemanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0080000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported, + {"VendorClassSupported", "infiniband.portinfo.capabilitymask.vendorclasssupported", FT_UINT32, BASE_HEX, NULL, 0x0100000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported, + {"DRNoticeSupported", "infiniband.portinfo.capabilitymask.drnoticesupported", FT_UINT32, BASE_HEX, NULL, 0x0200000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported, + {"CapabilityMaskNoticeSupported", "infiniband.portinfo.capabilitymask.capabilitymasknoticesupported", FT_UINT32, BASE_HEX, NULL, 0x0400000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported, + {"BootManagementSupported", "infiniband.portinfo.capabilitymask.bootmanagementsupported", FT_UINT32, BASE_HEX, NULL, 0x0800000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported, + {"LinkRoundTripLatencySupported", "infiniband.portinfo.capabilitymask.linkroundtriplatencysupported", FT_UINT32, BASE_HEX, NULL, 0x01000000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported, + {"ClientRegistrationSupported", "infiniband.portinfo.capabilitymask.clientregistrationsupported", FT_UINT32, BASE_HEX, NULL, 0x02000000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported, + {"OtherLocalChangesNoticeSupported", "infiniband.portinfo.capabilitymask.otherlocalchangesnoticesupported", FT_UINT32, BASE_HEX, NULL, 0x04000000, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported, + {"LinkSpeedWIdthPairsTableSupported", "infiniband.portinfo.capabilitymask.linkspeedwidthpairstablesupported", FT_UINT32, BASE_HEX, NULL, 0x08000000, NULL, HFILL} + }, + /* End Capability Mask Flags */ + {&hf_infiniband_PortInfo_DiagCode, + {"DiagCode", "infiniband.portinfo.diagcode", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_M_KeyLeasePeriod, + {"M_KeyLeasePeriod", "infiniband.portinfo.m_keyleaseperiod", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LocalPortNum, + {"LocalPortNum", "infiniband.portinfo.localportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LinkWidthEnabled, + {"LinkWidthEnabled", "infiniband.portinfo.linkwidthenabled", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LinkWidthSupported, + {"LinkWidthSupported", "infiniband.portinfo.linkwidthsupported", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LinkWidthActive, + {"LinkWidthActive", "infiniband.portinfo.linkwidthactive", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LinkSpeedSupported, + {"LinkSpeedSupported", "infiniband.portinfo.linkspeedsupported", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_PortState, + {"PortState", "infiniband.portinfo.portstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_PortPhysicalState, + {"PortPhysicalState", "infiniband.portinfo.portphysicalstate", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LinkDownDefaultState, + {"LinkDownDefaultState", "infiniband.portinfo.linkdowndefaultstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_M_KeyProtectBits, + {"M_KeyProtectBits", "infiniband.portinfo.m_keyprotectbits", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LMC, + {"LMC", "infiniband.portinfo.lmc", FT_UINT8, BASE_HEX, NULL, 0x07, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LinkSpeedActive, + {"LinkSpeedActive", "infiniband.portinfo.linkspeedactive", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LinkSpeedEnabled, + {"LinkSpeedEnabled", "infiniband.portinfo.linkspeedenabled", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_NeighborMTU, + {"NeighborMTU", "infiniband.portinfo.neighbormtu", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_MasterSMSL, + {"MasterSMSL", "infiniband.portinfo.mastersmsl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_VLCap, + {"VLCap", "infiniband.portinfo.vlcap", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_InitType, + {"InitType", "infiniband.portinfo.inittype", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_VLHighLimit, + {"VLHighLimit", "infiniband.portinfo.vlhighlimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_VLArbitrationHighCap, + {"VLArbitrationHighCap", "infiniband.portinfo.vlarbitrationhighcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_VLArbitrationLowCap, + {"VLArbitrationLowCap", "infiniband.portinfo.vlarbitrationlowcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_InitTypeReply, + {"InitTypeReply", "infiniband.portinfo.inittypereply", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_MTUCap, + {"MTUCap", "infiniband.portinfo.mtucap", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_VLStallCount, + {"VLStallCount", "infiniband.portinfo.vlstallcount", FT_UINT8, BASE_HEX, NULL, 0xE0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_HOQLife, + {"HOQLife", "infiniband.portinfo.hoqlife", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_OperationalVLs, + {"OperationalVLs", "infiniband.portinfo.operationalvls", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_PartitionEnforcementInbound, + {"PartitionEnforcementInbound", "infiniband.portinfo.partitionenforcementinbound", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_PartitionEnforcementOutbound, + {"PartitionEnforcementOutbound", "infiniband.portinfo.partitionenforcementoutbound", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_FilterRawInbound, + {"FilterRawInbound", "infiniband.portinfo.filterrawinbound", FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_FilterRawOutbound, + {"FilterRawOutbound", "infiniband.portinfo.filterrawoutbound", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_M_KeyViolations, + {"M_KeyViolations", "infiniband.portinfo.m_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_P_KeyViolations, + {"P_KeyViolations", "infiniband.portinfo.p_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_Q_KeyViolations, + {"Q_KeyViolations", "infiniband.portinfo.q_keyviolations", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_GUIDCap, + {"GUIDCap", "infiniband.portinfo.guidcap", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_ClientReregister, + {"ClientReregister", "infiniband.portinfo.clientreregister", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_SubnetTimeOut, + {"SubnetTimeOut", "infiniband.portinfo.subnettimeout", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_RespTimeValue, + {"RespTimeValue", "infiniband.portinfo.resptimevalue", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LocalPhyErrors, + {"LocalPhyErrors", "infiniband.portinfo.localphyerrors", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_OverrunErrors, + {"OverrunErrors", "infiniband.portinfo.overrunerrors", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_MaxCreditHint, + {"MaxCreditHint", "infiniband.portinfo.maxcredithint", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PortInfo_LinkRoundTripLatency, + {"LinkRoundTripLatency", "infiniband.portinfo.linkroundtriplatency", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* P_KeyTable */ + {&hf_infiniband_P_KeyTable_P_KeyTableBlock, + {"P_KeyTableBlock", "infiniband.p_keytable.p_keytableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_P_KeyTable_MembershipType, + {"MembershipType", "infiniband.p_keytable.membershiptype", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_P_KeyTable_P_KeyBase, + {"P_KeyBase", "infiniband.p_keytable.p_keybase", FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL} + }, + /* SLtoVLMappingTable */ + {&hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits, + {"SL(x)toVL", "infiniband.sltovlmappingtable.sltovlhighbits", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits, + {"SL(x)toVL", "infiniband.sltovlmappingtable.sltovllowbits", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + /* VLArbitrationTable */ + {&hf_infiniband_VLArbitrationTable_VLWeightPairs, + {"VLWeightPairs", "infiniband.vlarbitrationtable.vlweightpairs", FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL} + }, + {&hf_infiniband_VLArbitrationTable_VL, + {"VL", "infiniband.vlarbitrationtable.vl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + {&hf_infiniband_VLArbitrationTable_Weight, + {"Weight", "infiniband.vlarbitrationtable.weight", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* LinearForwardingTable */ + {&hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock, + {"LinearForwardingTableBlock", "infiniband.linearforwardingtable.linearforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + {&hf_infiniband_LinearForwardingTable_Port, + {"Port", "infiniband.linearforwardingtable.port", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* RandomForwardingTable */ + {&hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock, + {"RandomForwardingTableBlock", "infiniband.randomforwardingtable.randomforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x7FFF, NULL, HFILL} + }, + {&hf_infiniband_RandomForwardingTable_LID, + {"LID", "infiniband.randomforwardingtable.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_RandomForwardingTable_Valid, + {"Valid", "infiniband.randomforwardingtable.valid", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_RandomForwardingTable_LMC, + {"LMC", "infiniband.randomforwardingtable.lmc", FT_UINT16, BASE_HEX, NULL, 0x70, NULL, HFILL} + }, + {&hf_infiniband_RandomForwardingTable_Port, + {"Port", "infiniband.randomforwardingtable.port", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* MulticastForwardingTable */ + {&hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock , + {"MulticastForwardingTableBlock ", "infiniband.multicastforwardingtable.multicastforwardingtableblock", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MulticastForwardingTable_PortMask, + {"PortMask", "infiniband.multicastforwardingtable.portmask", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* SMInfo */ + {&hf_infiniband_SMInfo_GUID, + {"GUID", "infiniband.sminfo.guid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SMInfo_SM_Key, + {"SM_Key", "infiniband.sminfo.sm_key", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SMInfo_ActCount, + {"ActCount", "infiniband.sminfo.actcount", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SMInfo_Priority, + {"Priority", "infiniband.sminfo.priority", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_SMInfo_SMState, + {"SMState", "infiniband.sminfo.smstate", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + /* VendorDiag */ + {&hf_infiniband_VendorDiag_NextIndex, + {"NextIndex", "infiniband.vendordiag.nextindex", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_VendorDiag_DiagData, + {"DiagData", "infiniband.vendordiag.diagdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* LedInfo */ + {&hf_infiniband_LedInfo_LedMask, + {"LedMask", "infiniband.ledinfo.ledmask", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + /* LinkSpeedWidthPairsTable */ + {&hf_infiniband_LinkSpeedWidthPairsTable_NumTables, + {"NumTables", "infiniband.linkspeedwidthpairstable.numtables", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_LinkSpeedWidthPairsTable_PortMask, + {"PortMask", "infiniband.linkspeedwidthpairstable.portmask", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive, + {"Speed 2.5 Gbps", "infiniband.linkspeedwidthpairstable.speedtwofive", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive, + {"Speed 5 Gbps", "infiniband.linkspeedwidthpairstable.speedfive", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen, + {"Speed 10 Gbps", "infiniband.linkspeedwidthpairstable.speedten", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + /* NodeRecord */ + /* PortInfoRecord */ + /* SLtoVLMappingTableRecord */ + /* SwitchInfoRecord */ + /* LinearForwardingTableRecord */ + /* RandomForwardingTableRecord */ + /* MulticastForwardingTableRecord */ + /* VLArbitrationTableRecord */ + {&hf_infiniband_SA_LID, + {"LID", "infiniband.sa.lid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SA_EndportLID, + {"EndportLID", "infiniband.sa.endportlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SA_PortNum, + {"PortNum", "infiniband.sa.portnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SA_InputPortNum , + {"InputPortNum ", "infiniband.sa.inputportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SA_OutputPortNum, + {"OutputPortNum", "infiniband.sa.outputportnum", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SA_BlockNum_EightBit, + {"BlockNum_EightBit", "infiniband.sa.blocknum_eightbit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SA_BlockNum_NineBit, + {"BlockNum_NineBit", "infiniband.sa.blocknum_ninebit", FT_UINT16, BASE_HEX, NULL, 0x01FF, NULL, HFILL} + }, + {&hf_infiniband_SA_BlockNum_SixteenBit, + {"BlockNum_SixteenBit", "infiniband.sa.blocknum_sixteenbit", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_SA_Position, + {"Position", "infiniband.sa.position", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_SA_Index, + {"Index", "infiniband.sa.index", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* InformInfoRecord */ + {&hf_infiniband_InformInfoRecord_SubscriberGID, + {"SubscriberGID", "infiniband.informinforecord.subscribergid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_InformInfoRecord_Enum, + {"Enum", "infiniband.informinforecord.enum", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* InformInfo */ + {&hf_infiniband_InformInfo_GID, + {"GID", "infiniband.informinfo.gid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_InformInfo_LIDRangeBegin, + {"LIDRangeBegin", "infiniband.informinfo.lidrangebegin", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_InformInfo_LIDRangeEnd, + {"LIDRangeEnd", "infiniband.informinfo.lidrangeend", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_InformInfo_IsGeneric, + {"IsGeneric", "infiniband.informinfo.isgeneric", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_InformInfo_Subscribe, + {"Subscribe", "infiniband.informinfo.subscribe", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_InformInfo_Type, + {"Type", "infiniband.informinfo.type", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_InformInfo_TrapNumberDeviceID, + {"TrapNumberDeviceID", "infiniband.informinfo.trapnumberdeviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_InformInfo_QPN, + {"QPN", "infiniband.informinfo.qpn", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_InformInfo_RespTimeValue, + {"RespTimeValue", "infiniband.informinfo.resptimevalue", FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL} + }, + {&hf_infiniband_InformInfo_ProducerTypeVendorID, + {"ProducerTypeVendorID", "infiniband.informinfo.producertypevendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* LinkRecord */ + {&hf_infiniband_LinkRecord_FromLID, + {"FromLID", "infiniband.linkrecord.fromlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_LinkRecord_FromPort, + {"FromPort", "infiniband.linkrecord.fromport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_LinkRecord_ToPort, + {"ToPort", "infiniband.linkrecord.toport", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_LinkRecord_ToLID, + {"ToLID", "infiniband.linkrecord.tolid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* ServiceRecord */ + {&hf_infiniband_ServiceRecord_ServiceID, + {"ServiceID", "infiniband.linkrecord.serviceid", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_ServiceRecord_ServiceGID, + {"ServiceGID", "infiniband.linkrecord.servicegid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_ServiceRecord_ServiceP_Key, + {"ServiceP_Key", "infiniband.linkrecord.servicep_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_ServiceRecord_ServiceLease, + {"ServiceLease", "infiniband.linkrecord.servicelease", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_ServiceRecord_ServiceKey, + {"ServiceKey", "infiniband.linkrecord.servicekey", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_ServiceRecord_ServiceName, + {"ServiceName", "infiniband.linkrecord.servicename", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_ServiceRecord_ServiceData, + {"ServiceData", "infiniband.linkrecord.servicedata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* ServiceAssociationRecord */ + {&hf_infiniband_ServiceAssociationRecord_ServiceKey, + {"ServiceKey", "infiniband.serviceassociationrecord.servicekey", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_ServiceAssociationRecord_ServiceName, + {"ServiceName", "infiniband.serviceassociationrecord.servicename", FT_STRING, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* PathRecord */ + {&hf_infiniband_PathRecord_DGID, + {"DGID", "infiniband.pathrecord.dgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_SGID, + {"SGID", "infiniband.pathrecord.sgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_DLID, + {"DLID", "infiniband.pathrecord.dlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_SLID, + {"SLID", "infiniband.pathrecord.slid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_RawTraffic, + {"RawTraffic", "infiniband.pathrecord.rawtraffic", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_FlowLabel, + {"FlowLabel", "infiniband.pathrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0xFFFFF0, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_HopLimit, + {"HopLimit", "infiniband.pathrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_TClass, + {"TClass", "infiniband.pathrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_Reversible, + {"Reversible", "infiniband.pathrecord.reversible", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_NumbPath, + {"NumbPath", "infiniband.pathrecord.numbpath", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_P_Key, + {"P_Key", "infiniband.pathrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_SL, + {"SL", "infiniband.pathrecord.sl", FT_UINT16, BASE_HEX, NULL, 0x000F, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_MTUSelector, + {"MTUSelector", "infiniband.pathrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_MTU, + {"MTU", "infiniband.pathrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_RateSelector, + {"RateSelector", "infiniband.pathrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_Rate, + {"Rate", "infiniband.pathrecord.rate", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_PacketLifeTimeSelector, + {"PacketLifeTimeSelector", "infiniband.pathrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_PacketLifeTime, + {"PacketLifeTime", "infiniband.pathrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL} + }, + {&hf_infiniband_PathRecord_Preference, + {"Preference", "infiniband.pathrecord.preference", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* MCMemberRecord */ + {&hf_infiniband_MCMemberRecord_MGID, + {"MGID", "infiniband.mcmemberrecord.mgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_PortGID, + {"PortGID", "infiniband.mcmemberrecord.portgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_Q_Key, + {"Q_Key", "infiniband.mcmemberrecord.q_key", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_MLID, + {"MLID", "infiniband.mcmemberrecord.mlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_MTUSelector, + {"MTUSelector", "infiniband.mcmemberrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_MTU, + {"MTU", "infiniband.mcmemberrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_TClass, + {"TClass", "infiniband.mcmemberrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_P_Key, + {"P_Key", "infiniband.mcmemberrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_RateSelector, + {"RateSelector", "infiniband.mcmemberrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_Rate, + {"Rate", "infiniband.mcmemberrecord.rate", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_PacketLifeTimeSelector, + {"PacketLifeTimeSelector", "infiniband.mcmemberrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_PacketLifeTime, + {"PacketLifeTime", "infiniband.mcmemberrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_SL, + {"SL", "infiniband.mcmemberrecord.sl", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_FlowLabel, + {"FlowLabel", "infiniband.mcmemberrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_HopLimit, + {"HopLimit", "infiniband.mcmemberrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_Scope, + {"Scope", "infiniband.mcmemberrecord.scope", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_JoinState, + {"JoinState", "infiniband.mcmemberrecord.joinstate", FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL} + }, + {&hf_infiniband_MCMemberRecord_ProxyJoin, + {"ProxyJoin", "infiniband.mcmemberrecord.proxyjoin", FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL} + }, + /* MultiPathRecord */ + {&hf_infiniband_MultiPathRecord_RawTraffic, + {"RawTraffic", "infiniband.multipathrecord.rawtraffic", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_FlowLabel, + {"FlowLabel", "infiniband.multipathrecord.flowlabel", FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_HopLimit, + {"HopLimit", "infiniband.multipathrecord.hoplimit", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_TClass, + {"TClass", "infiniband.multipathrecord.tclass", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_Reversible, + {"Reversible", "infiniband.multipathrecord.reversible", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_NumbPath, + {"NumbPath", "infiniband.multipathrecord.numbpath", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_P_Key, + {"P_Key", "infiniband.multipathrecord.p_key", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_SL, + {"SL", "infiniband.multipathrecord.sl", FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_MTUSelector, + {"MTUSelector", "infiniband.multipathrecord.mtuselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_MTU, + {"MTU", "infiniband.multipathrecord.mtu", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_RateSelector, + {"RateSelector", "infiniband.multipathrecord.rateselector", FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_Rate, + {"Rate", "infiniband.multipathrecord.rate", FT_UINT8, BASE_HEX, NULL, 0xFC, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_PacketLifeTimeSelector, + {"PacketLifeTimeSelector", "infiniband.multipathrecord.packetlifetimeselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_PacketLifeTime, + {"PacketLifeTime", "infiniband.multipathrecord.packetlifetime", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_IndependenceSelector, + {"IndependenceSelector", "infiniband.multipathrecord.independenceselector", FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_GIDScope, + {"GIDScope", "infiniband.multipathrecord.gidscope", FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_SGIDCount, + {"SGIDCount", "infiniband.multipathrecord.sgidcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_DGIDCount, + {"DGIDCount", "infiniband.multipathrecord.dgidcount", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_MultiPathRecord_SDGID, + {"SDGID", "infiniband.multipathrecord.sdgid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* Notice */ + {&hf_infiniband_Notice_IsGeneric, + {"IsGeneric", "infiniband.notice.isgeneric", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_Notice_Type, + {"Type", "infiniband.notice.type", FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL} + }, + {&hf_infiniband_Notice_ProducerTypeVendorID, + {"ProducerTypeVendorID", "infiniband.notice.producertypevendorid", FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_Notice_TrapNumberDeviceID, + {"TrapNumberDeviceID", "infiniband.notice.trapnumberdeviceid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_Notice_IssuerLID, + {"IssuerLID", "infiniband.notice.issuerlid", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_Notice_NoticeToggle, + {"NoticeToggle", "infiniband.notice.noticetoggle", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_Notice_NoticeCount, + {"NoticeCount", "infiniband.notice.noticecount", FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL} + }, + {&hf_infiniband_Notice_DataDetails, + {"DataDetails", "infiniband.notice.datadetails", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_Notice_IssuerGID, + {"IssuerGID", "infiniband.notice.issuergid", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_Notice_ClassTrapSpecificData, + {"ClassTrapSpecificData", "infiniband.notice.classtrapspecificdata", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* Traps 64,65,66,67 */ + {&hf_infiniband_Trap_GIDADDR, + {"GIDADDR", "infiniband.trap.gidaddr", FT_IPv6, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* Traps 68,69 */ + {&hf_infiniband_Trap_COMP_MASK, + {"COMP_MASK", "infiniband.trap.comp_mask", FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_Trap_WAIT_FOR_REPATH, + {"WAIT_FOR_REPATH", "infiniband.trap.wait_for_repath", FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL} + }, + {&hf_infiniband_Trap_PATH_REC, + {"PATH_REC", "infiniband.trap.path_rec", FT_BYTES, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* Trap 128 */ + {&hf_infiniband_Trap_LIDADDR, + {"LIDADDR", "infiniband.trap.lidaddr", FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* Trap 129, 130, 131 */ + {&hf_infiniband_Trap_PORTNO, + {"PORTNO", "infiniband.trap.portno", FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + /* Trap 144 */ + {&hf_infiniband_Trap_OtherLocalChanges, + {"OtherLocalChanges", "infiniband.trap.otherlocalchanges", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_CAPABILITYMASK, + {"CAPABILITYMASK", "infiniband.trap.capabilitymask", FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL} + }, + {&hf_infiniband_Trap_LinkSpeecEnabledChange, + {"LinkSpeecEnabledChange", "infiniband.trap.linkspeecenabledchange", FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL} + }, + {&hf_infiniband_Trap_LinkWidthEnabledChange, + {"LinkWidthEnabledChange", "infiniband.trap.linkwidthenabledchange", FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL} + }, + {&hf_infiniband_Trap_NodeDescriptionChange, + {"NodeDescriptionChange", "infiniband.trap.nodedescriptionchange", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + /* Trap 145 */ + {&hf_infiniband_Trap_SYSTEMIMAGEGUID, + {"SYSTEMIMAGEGUID", "infiniband.trap.systemimageguid", FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + /* Trap 256 */ + {&hf_infiniband_Trap_DRSLID, + {"DRSLID", "infiniband.trap.drslid", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_METHOD, + {"METHOD", "infiniband.trap.method", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_ATTRIBUTEID, + {"ATTRIBUTEID", "infiniband.trap.attributeid", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_ATTRIBUTEMODIFIER, + {"ATTRIBUTEMODIFIER", "infiniband.trap.attributemodifier", FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_MKEY, + {"MKEY", "infiniband.trap.mkey", FT_UINT64, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_DRNotice, + {"DRNotice", "infiniband.trap.drnotice", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_DRPathTruncated, + {"DRPathTruncated", "infiniband.trap.drpathtruncated", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_DRHopCount, + {"DRHopCount", "infiniband.trap.drhopcount", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_DRNoticeReturnPath, + {"DRNoticeReturnPath", "infiniband.trap.drnoticereturnpath", FT_BYTES, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + /* Trap 257, 258 */ + {&hf_infiniband_Trap_LIDADDR1, + {"LIDADDR1", "infiniband.trap.lidaddr1", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_LIDADDR2, + {"LIDADDR2", "infiniband.trap.lidaddr2", FT_UINT16, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_KEY, + {"KEY", "infiniband.trap.key", FT_UINT32, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_SL, + {"SL", "infiniband.trap.sl", FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_QP1, + {"QP1", "infiniband.trap.qp1", FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_QP2, + {"QP2", "infiniband.trap.qp2", FT_UINT24, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_GIDADDR1, + {"GIDADDR1", "infiniband.trap.gidaddr1", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_GIDADDR2, + {"GIDADDR2", "infiniband.trap.gidaddr2", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + /* Trap 259 */ + {&hf_infiniband_Trap_DataValid, + {"DataValid", "infiniband.trap.datavalid", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_PKEY, + {"PKEY", "infiniband.trap.pkey", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL} + }, + {&hf_infiniband_Trap_SWLIDADDR, + {"SWLIDADDR", "infiniband.trap.swlidaddr", FT_IPv6, BASE_HEX, NULL, 0x01, NULL, HFILL} + } }; +/* Array to hold expansion options between dissections */ static gint *ett[] = { - &ett_infiniband + &ett_infiniband, + &ett_all_headers, + &ett_lrh, + &ett_grh, + &ett_bth, + &ett_rwh, + &ett_rawdata, + &ett_rdeth, + &ett_deth, + &ett_reth, + &ett_atomiceth, + &ett_aeth, + &ett_atomicacketh, + &ett_immdt, + &ett_ieth, + &ett_payload, + &ett_vendor, + &ett_subn_lid_routed, + &ett_subn_directed_route, + &ett_subnadmin, + &ett_mad, + &ett_rmpp, + &ett_subm_attribute, + &ett_suba_attribute, + &ett_datadetails, + &ett_noticestraps, + &ett_nodedesc, + &ett_nodeinfo, + &ett_switchinfo, + &ett_guidinfo, + &ett_portinfo, + &ett_portinfo_capmask, + &ett_pkeytable, + &ett_sltovlmapping, + &ett_vlarbitrationtable, + &ett_linearforwardingtable, + &ett_randomforwardingtable, + &ett_multicastforwardingtable, + &ett_sminfo, + &ett_vendordiag, + &ett_ledinfo, + &ett_linkspeedwidthpairs, + &ett_informinfo, + &ett_linkrecord, + &ett_servicerecord, + &ett_pathrecord, + &ett_mcmemberrecord, + &ett_tracerecord, + &ett_multipathrecord, + &ett_serviceassocrecord }; |